KEGG   Mycobacterium sp. MOTT36Y: W7S_09795Help
Entry
W7S_09795         CDS       T02113                                 

Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
mmm  Mycobacterium sp. MOTT36Y
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mmm00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    W7S_09795
Enzymes [BR:mmm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     W7S_09795
Transfer RNA biogenesis [BR:mmm03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    W7S_09795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2122253..2122981
Genome map
AA seq 242 aa AA seqDB search
MNDHDLAARLATDAGQLLLGVRQEFADAEASERKAAGDKRSHDFLMAALAAERPGDAVLS
EEGADNPVRLRAERVWIVDPLDGTREFSELGRDDWAVHVALWEAGELVAGAVALPAQGIT
FATPDIASPPAAPGKPRIVVSRTRPPAIALNVRDALDGVLVEMGSAGAKVASIVQGLSDV
YVHAGGQYEWDSAAPVAVARAAGLHTSRIDGSALAYNQPDPKLPDLVVCRPELAEAVLAV
TG
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaccatgacctggccgcgcggttggccaccgacgcgggccagctgctgctcggg
gtccggcaagagttcgccgacgcggaagcgagcgaacggaaagcggcgggggacaagcga
tcccacgactttctgatggcggcgctcgccgcggagcgccccggggacgcggtgctgtcc
gaggagggcgccgacaacccggtgcggttgcgcgcggagcgcgtctggatcgtcgatccg
ctggacgggacgcgggagttctccgagctcgggcgcgacgactgggcggtgcacgtcgcg
ttgtgggaggccggcgagctggttgccggggcggtggcgctgccggcgcagggcatcacg
ttcgccacccccgacatcgcgtcgcctccggcggcgccgggcaagccgcggatcgtggtc
tcgcgcacccgcccgcccgccatcgcgctgaacgtccgggacgccctggacggcgttctg
gtcgaaatgggttcggccggcgccaaggtggcgtcgatcgtccagggcttgtccgatgtg
tacgtgcacgccggcgggcagtacgaatgggactccgccgccccggtggcggtggcgcgc
gccgcggggctgcacacctcccgcatcgacgggtccgccctggcctacaaccagccggac
ccgaagctgccggacctcgtcgtgtgccgtcccgagctcgcggaagccgtactcgcggtt
accggctga

DBGET integrated database retrieval system