KEGG   Mycobacterium sp. MOTT36Y: W7S_11405Help
Entry
W7S_11405         CDS       T02113                                 

Definition
inositol monophosphatase family protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
mmm  Mycobacterium sp. MOTT36Y
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mmm00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    W7S_11405
Enzymes [BR:mmm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     W7S_11405
Transfer RNA biogenesis [BR:mmm03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    W7S_11405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2460941..2461741
Genome map
AA seq 266 aa AA seqDB search
MSHAPDDESDEMTDAALAADLAAEAGELLLKVRDEVGFGYPWALGDAGDSLANDLILRRL
RVERPGDAVLSEEAYDDLSRLQHDRVWIIDPLDGTREFSTPGRDDWAVHIALWQRPSDGQ
REITDAAVSLPARGNIVYRSDTVTAGAARAGVTDTIRIAVSATRPPAVLHRMRQTLPIQP
VAIGSAGAKAMAIIDGDVDAYVHAGGQWEWDSAAPAGVVMAAGMHASRLDGSPMRYNQLD
PYLPDFVMCRAELAPILLGAIRDAWR
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
gtgagccatgcccccgacgacgagtcggacgagatgaccgatgccgcgctggccgccgat
ctcgccgccgaagcgggggagttattgctcaaggtccgcgacgaggtcgggttcggctat
ccctgggcgctgggcgacgcgggtgacagcctggcgaacgacctgatcctgcggcggctg
cgcgtcgagcggcccggcgacgcggtgctcagcgaggaggcctacgacgacctgtcccgg
ctgcagcacgaccgggtgtggatcatcgacccgctggacggcacccgcgagttctccacg
ccgggccgcgacgactgggcggtccacatcgcgctgtggcagcgacccagcgatggccaa
cgcgagatcaccgacgcggcggtgtcattgcccgcgcgtggcaacatcgtctaccgcagc
gacaccgtgacggccggcgccgcccgcgccggcgtcaccgacaccatccgcatcgccgtc
agcgccacccggcccccggcggtcctgcaccggatgcggcagacgctgcccattcagccg
gtcgcgatcggctcggcgggcgccaaggcgatggccatcatcgacggcgacgtcgacgcc
tacgtgcacgccggcggccagtgggagtgggactcggccgccccggccggggtggtgatg
gccgccgggatgcacgcctcgcggctcgacggatcgccgatgcgctacaaccagctcgac
ccgtacctgcccgacttcgtcatgtgccgcgccgagctggccccgatcctgctgggagcc
atccgcgacgcctggcgctaa

DBGET integrated database retrieval system