KEGG   Mycobacterium sp. MOTT36Y: W7S_11935Help
Entry
W7S_11935         CDS       T02113                                 

Definition
hypothetical protein
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
mmm  Mycobacterium sp. MOTT36Y
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    W7S_11935
Enzymes [BR:mmm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     W7S_11935
    3.5.1.-  
     W7S_11935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2613016..2613576
Genome map
AA seq 186 aa AA seqDB search
MRALIVVDVQNDFCEGGAVPVAGGAAVAPAINAYLSSAPGYRHVVATQDFHIDPGGHFSD
RPDYSSTWPPHCVAGSAGAEFRPDLDTARIDAVFRKGAYSAGYSGFEGADENGTPLLEWL
RQRGIDDVDVAGIATDHCVRRTSEDAARAGLRTRVLVDLTAATTADAAAQALAELESVGV
ELVGGS
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
gtgcgagcgttgatcgtcgtcgacgtgcaaaacgatttctgcgagggcggcgccgtgccg
gtggccggcggcgccgccgtggcgcccgccatcaacgcctacctgtctagcgcgccgggc
tatcgccacgtggtggccacccaggacttccacatcgacccgggcgggcatttctccgac
cggccggactattcctcgacctggccgccgcactgcgtcgccggaagcgcgggcgccgaa
tttcggcccgacttggacaccgcgcgcatcgatgccgtctttcgcaaaggcgcctactcc
gcggggtacagtgggttcgaaggtgccgacgagaacggcacccccctcctggagtggttg
cggcagcgcggcattgacgacgtcgacgtggccggcatcgccaccgaccattgcgtccgg
cggacctccgaggacgcggcgcgggcgggtctgaggacccgggtgctcgtcgacctgacc
gcggccacaacagcggatgcggccgcccaggcgctggcggaattggaatccgtcggcgtc
gaattggtggggggatcgtaa

DBGET integrated database retrieval system