KEGG   Mycobacterium sp. MOTT36Y: W7S_11935Help
Entry
W7S_11935         CDS       T02113                                 

Definition
hypothetical protein
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
mmm  Mycobacterium sp. MOTT36Y
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:mmm00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2613016..2613576
Genome map
AA seq 186 aa AA seqDB search
MRALIVVDVQNDFCEGGAVPVAGGAAVAPAINAYLSSAPGYRHVVATQDFHIDPGGHFSD
RPDYSSTWPPHCVAGSAGAEFRPDLDTARIDAVFRKGAYSAGYSGFEGADENGTPLLEWL
RQRGIDDVDVAGIATDHCVRRTSEDAARAGLRTRVLVDLTAATTADAAAQALAELESVGV
ELVGGS
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
gtgcgagcgttgatcgtcgtcgacgtgcaaaacgatttctgcgagggcggcgccgtgccg
gtggccggcggcgccgccgtggcgcccgccatcaacgcctacctgtctagcgcgccgggc
tatcgccacgtggtggccacccaggacttccacatcgacccgggcgggcatttctccgac
cggccggactattcctcgacctggccgccgcactgcgtcgccggaagcgcgggcgccgaa
tttcggcccgacttggacaccgcgcgcatcgatgccgtctttcgcaaaggcgcctactcc
gcggggtacagtgggttcgaaggtgccgacgagaacggcacccccctcctggagtggttg
cggcagcgcggcattgacgacgtcgacgtggccggcatcgccaccgaccattgcgtccgg
cggacctccgaggacgcggcgcgggcgggtctgaggacccgggtgctcgtcgacctgacc
gcggccacaacagcggatgcggccgcccaggcgctggcggaattggaatccgtcggcgtc
gaattggtggggggatcgtaa

DBGET integrated database retrieval system