KEGG   Mycobacterium sp. MOTT36Y: W7S_12310Help
Entry
W7S_12310         CDS       T02113                                 

Definition
terpene synthesis protein
Orthology
K10533  
limonene-1,2-epoxide hydrolase [EC:3.3.2.8]
Organism
mmm  Mycobacterium sp. MOTT36Y
Pathway
Limonene and pinene degradation
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mmm00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    W7S_12310
Enzymes [BR:mmm01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.8  limonene-1,2-epoxide hydrolase
     W7S_12310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2687049..2687492)
Genome map
AA seq 147 aa AA seqDB search
MSKSVATKNDNEKIVVDFIHAAYGASMDIDAMTALMAEDFVWQLHVPLSPVVRGRDAARA
ELEKHNTLSTGMVEGSEIRRIVSDGDTVVVERVDVNSMNGVAVTFYVTAIFEVRDSAITH
WREYWDTAHVAQQLGIDPALMFAPLTN
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaaagtgttgcaaccaaaaacgacaacgagaagatcgtggtcgactttatacat
gccgcttacggcgcgagcatggacatcgacgcgatgaccgcgctcatggccgaggacttc
gtgtggcaactccacgttccgctgtccccggtcgtgcggggacgcgacgcggcgcgcgca
gaactcgagaagcacaacacgctgtcgaccggcatggtcgagggaagcgagattcgcagg
atcgtgtccgacggcgacaccgtcgtcgtcgaacgagtcgacgtgaactctatgaatggc
gtggccgtcacgttttatgtcacagccattttcgaggttcgcgacagtgcgatcactcat
tggcgagagtattgggacaccgcccacgtcgcgcagcaactcggcatcgatcccgcgctg
atgttcgccccgctgacgaattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system