KEGG   Mycobacterium sp. MOTT36Y: W7S_12690Help
Entry
W7S_12690         CDS       T02113                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
mmm  Mycobacterium sp. MOTT36Y
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:mmm01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:mmm00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2762251..2764539)
Genome map
AA seq 762 aa AA seqDB search
MAIIDKDTQVRPSFDDEVAATQQYFDDPRFSRITRLYTARQVAEQRGTIPTDYTVARNAA
AAFYERLRELFAQKKSITTFGPYSPGQAVAMKRMGIEGIYLGGWATSAKGSTTEDPGPDL
ASYPLSQVPDDAAVLVRALLTADRNQQYQRLQMSEKQRAAAPVYDYRPFIIADADTGHGG
DPHVRNLIRRFVEVGVPGYHIEDQRPGTKKCGHQGGKVLVPSDEQIKRLNTARFQLDIMK
VPGIIVARTDAEAANLLDSRADERDQPFLLGATNLKIPSYKSCFLALVRRFYELGVKDLN
GHLLYALPEGEYAEATAWLERQGIQGLVSDAVNAWREDGQQSIDDLFDQVESRFVAAWED
DAGLMTYGEAVADVLAFAASEGEPADMSAEEWREFAATASLYSARAKAKELGVDPGWDCE
LSKTPEGYYQIRGGIPYAIAKSLAAAPFADLLWMETKTADLDDARQFADAIHAKFPDQML
AYNLSPSFNWDTTGMTDEQMKQFPEELGKMGFVFNFITYGGHQIDGVAAEEFATSLQQDG
MLALARLQRKMRLVESPYRTPQTLVGGPRSDAALTASSGRTATTKSMGEGSTQHQHLVQT
EVPKKLLEEWLAMWSENYDLGEKLRVQLRPRRAGSDVLELGIYGNDDEQLANVVVDPIKD
RHGRSILQVRDQNTFAEKLRQKRLMTLIHLWLVHRFKADGVIYVTPTEDNLYQTSKMKSH
GIFSEVYQEVGEIIVAEVNQPRIAELLKPDRVALRKLITKEG
NT seq 2289 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcatcgacaaggacacacaagtccggccatcgttcgacgacgaggtcgctgcc
acgcagcaatacttcgacgatccgcgcttttcccggatcacccgcctgtacaccgcccgc
caggtagccgagcagcgcggcaccatcccgaccgactacaccgtggcacgaaacgcggcg
gcggccttctacgagcggttgcgcgagctgttcgcccagaagaagagcatcacgacgttc
ggcccgtactcgcccggccaggcggtcgcgatgaagcggatgggcatcgaggggatctat
ctgggcggctgggccacctcggccaaggggtccaccaccgaagatcccggacccgacctc
gccagctacccgctgagccaggtgcccgacgacgccgcggtgctggtgcgcgccctgctg
accgccgaccgcaaccagcaataccagcgcctgcagatgagcgaaaagcagcgcgccgcg
gccccggtctacgactaccggccgttcatcatcgccgacgcggacaccggccacggcggt
gacccgcacgtgcgcaacctgatccgccggttcgtcgaggtcggcgtgcccggctaccac
atcgaggaccagcgccccggcaccaagaagtgcggccatcagggcggcaaggtgttggtg
ccgtccgacgaacagatcaaacggctcaacaccgctcgcttccagctcgacatcatgaag
gtgccgggcatcatcgtcgcgcgcaccgacgccgaggccgccaacctgctggacagccgg
gccgacgagcgtgaccagccgttcctgctcggagccaccaacctcaagatcccgtcctac
aagtcgtgcttcctggcgttggtgcgtcgcttctacgagctgggcgtcaaagacctcaac
ggccacctgctgtacgcgctgcccgaaggggagtacgccgaggccacagcttggcttgag
cgccaagggatccagggcctggtctccgacgccgtcaacgcctggcgggaggacggtcaa
cagtcgatcgacgacctgttcgaccaagtcgagtcgcggttcgtggcggcctgggaggac
gacgccggcctgatgacctacggcgaggccgtcgccgatgtgctcgcgttcgccgccagc
gagggcgaaccggccgatatgagcgccgaggagtggcgggagttcgccgcgaccgcctcg
ctctactcggccagggccaaggcgaaggagttgggcgtcgaccccggttgggactgcgaa
ctctcgaagacgcccgagggctactaccagatccgcggcggcatcccgtacgccatcgcc
aaatcgctggcggccgcgccattcgccgacctcttgtggatggagaccaagaccgccgac
ctggacgacgcccggcagttcgccgacgccatccacgccaagttccccgaccagatgctg
gcctacaacctgtccccgtcgttcaactgggacaccaccggcatgaccgacgagcagatg
aagcagttccccgaggaactgggcaagatgggtttcgtcttcaacttcatcacctacggc
ggacaccagatcgacggcgtcgccgccgaggagttcgccacctcgctgcaacaggacggc
atgttggcgctggcccggctgcagcgcaagatgcgcctggtcgaatctccttaccgcaca
ccgcaaaccctcgtcgggggaccgcgcagcgacgccgcgctcacggcctcctcgggccgc
accgccaccaccaagtcgatgggcgaaggctcgacccagcaccagcacctggtgcagacc
gaggtgccgaagaagctgctcgaggagtggctggcgatgtggagcgagaactacgacctc
ggcgagaaactgcgggtgcaactgcggccccgccgggccggctcggacgtgctcgaactc
ggcatctacggcaacgacgacgagcagctggccaacgtggtcgtcgacccgatcaaggac
cggcacggccgcagcatccttcaggtgcgcgaccagaacaccttcgcggagaagctccgg
cagaagcggctgatgaccttgatccacctctggctggtgcaccgcttcaaggccgacggg
gtgatctatgtgacgccgaccgaggacaacctctatcagacctcgaagatgaaatcccac
ggcatcttcagcgaggtctaccaggaggtcggcgagatcatcgtcgccgaggtgaatcag
ccccgcatcgccgaactgctcaagcccgaccgcgtggcgctgcgcaagctgatcaccaag
gaggggtag

DBGET integrated database retrieval system