KEGG   Mycobacterium sp. MOTT36Y: W7S_13155Help
Entry
W7S_13155         CDS       T02113                                 

Definition
(RefSeq) malate synthase G (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
mmm  Mycobacterium sp. MOTT36Y
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mmm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    W7S_13155
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    W7S_13155
   00630 Glyoxylate and dicarboxylate metabolism
    W7S_13155
Enzymes [BR:mmm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     W7S_13155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2852937..2855132
Genome map
AA seq 731 aa AA seqDB search
MTDRVSAGNLRVARVLYDFVNEEALPGTDIDPDSFWAGVDKVVTDLTPKNQDLLRRRDEL
QAQIDKWHRQRVIEPLDIDAYREFLTEIGYLLPEPADFTITTSGVDDEITTTAGPQLVVP
VLNARFALNAANARWGSLYDALYGTDVISEDDGAEKGSSYNKVRGDKVIAYARKFLDEAV
PLESGSWADATGLSVEDGRLKVATADGSAGLADPDKFAGYTGELGSPSWSVLLVNHGLHI
EILIDPDSPIGKTDAAGIKDVILESAVTTIMDFEDSVAAVDADDKVLGYRNWLGLNKGDL
SEDVDKGGKTFTRVLNQDRTYSTPDGEGELTLPGRSLLFVRNVGHLMTNDAIIDAEGHEV
FEGIMDALFTGLTAIHGLKTSEANGPLANSRTGSIYIVKPKMHGPDEVAFTCELFSRVED
VLGLPQGTLKVGIMDEERRTTVNLKACIKAAADRVVFINTGFLDRTGDEIHTSMEAGPMI
RKGAMKGTTWIKAYEDANVDIGLAAGFKGKAQIGKGMWAMTELMADMVEQKIGQPKAGAT
TAWVPSPTAATLHAMHYHYVDVGAVQEELAGKKRTNIDELLTIPLAKELAWAPEEIREEV
DNNCQSILGYVVRWVAQGVGCSKVPDIHDVALMEDRATLRISSQLLANWLRHGVITEEDV
RASLERMAPLVDEQNAKDAAYLPMAPNFDDSLAFLAAQDLILTGTQQPNGYTEPILHRRR
REAKARAAQSN
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atgactgatcgcgtgtcggcggggaacttgcgcgtcgcccgggtgctttacgacttcgtg
aacgaagaggccttgcccggcaccgatatcgacccggacagcttctgggccggcgtggac
aaggtcgtcaccgacctcaccccgaagaaccaggatctgctgcgccggcgtgacgagctg
caggcccagatcgacaagtggcaccggcagcgggtcatcgagccgctcgacatcgacgcc
tatcgcgagttcctcaccgaaatcggttacctgctgcccgaacccgcggatttcacgatc
accacctcgggcgtcgacgacgagatcaccacgaccgcgggcccccagctcgtggtgccg
gtgctcaacgcccggttcgcgctgaacgccgccaacgcccggtggggttcgctctacgac
gccctgtacggcaccgacgtcatctcggaggacgacggcgccgaaaaggggtcgagctac
aacaaggtgcgtggcgacaaggtcatcgcctacgcgcgcaaattcctggacgaggccgtg
ccgctggaatccggctcgtgggccgacgcgaccggtctgtccgtcgaggacggccgcctg
aaggtcgcgaccgccgacggttccgccggcctggccgacccggacaagttcgccggctac
accggcgagctcggctcccccagctggtcggtgctgctggtcaaccacggcctgcacatc
gagatcctcatcgatccggactcgccgatcggcaagaccgacgccgccggcatcaaggac
gtgatcctggaatcggccgtgaccacgatcatggacttcgaggactcggtggccgccgtc
gacgccgacgacaaggtgctcggctaccgcaactggctcggcctgaacaagggcgacctg
tccgaggacgtcgacaagggcggcaagaccttcacccgggtgctcaaccaggaccgcacc
tactccacgcccgacggcgagggcgagctgaccctgccgggccgcagcctgctgttcgtc
cgcaacgtcggccacctgatgaccaacgacgcgattatcgacgcggagggtcacgaggtg
ttcgagggcatcatggatgcgctgttcaccgggctgaccgcgattcacgggctcaagacg
agtgaggcgaacgggccgctggccaacagccgcaccgggtccatctacatcgtcaagccc
aagatgcacgggcccgacgaggtcgcgttcacctgcgagctgttcagccgggtcgaagac
gtcctcgggctgccgcagggcaccctcaaggtcggcatcatggacgaggagcggcgcacc
accgtcaacctcaaggcctgcatcaaggccgcggccgaccgggtggtgttcatcaacacc
ggcttcctcgaccgcaccggcgacgagatccacacctcgatggaggcgggtccgatgatc
cgcaagggcgcgatgaagggcaccacctggatcaaggcctacgaggacgccaacgtcgac
atcggcctggccgccgggttcaagggcaaggcgcagatcggcaagggcatgtgggcgatg
accgaactgatggccgacatggtcgagcagaagatcggccagcccaaggccggagccacc
accgcgtgggtgccctcgccgacggcggccaccctgcacgcgatgcactaccactacgtc
gacgtgggcgccgtgcaggaggagctggcgggcaagaagcgcaccaacatcgacgagttg
ctgaccatcccgctggccaaggaactggcctgggctcccgaggagatccgcgaggaggtc
gacaacaactgccagtccatcctcggctacgtggtgcgctgggtcgcccagggcgtcggc
tgctcgaaggtgcccgacatccacgacgtggcgctcatggaagaccgtgcgacactgcgg
atttcgagtcagctgctggcgaactggctgcgccacggtgtgatcaccgaggaggacgtg
cgggccagcctcgagcggatggccccgctggtggacgagcaaaacgccaaggatgcggcg
tatttgccgatggcgcccaacttcgacgacagcctggcgttcctggcggcgcaggacctc
atcctgaccggaacgcagcagcccaacggctacaccgagccgatcctgcaccgccgtcgg
cgcgaggccaaggcgcgcgccgcgcagtcgaattga

DBGET integrated database retrieval system