KEGG   Mycobacterium sp. MOTT36Y: W7S_13395Help
Entry
W7S_13395         CDS       T02113                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
mmm  Mycobacterium sp. MOTT36Y
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mmm00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2911416..2913599
Genome map
AA seq 727 aa AA seqDB search
MTELAPSLIELARRYGIATEYEDWSGRRVRVSEATLKAVLAALGVAADDEQERNLALTAK
LRSHWARRLPATIVGRTGEQIRFWAHVTHGAPAEVWLTLEDGTVRGDVAQVDNFTPPFDL
DGRWVGEASFLLPTDLPLGYHRVHLRSGDSETSTALIVTPDWLGLPERLGNRRAWGLAVQ
LYSVRSRRSWGVGDLTDLTDLAVWSASRHGADYLLVNPLHAAAPAGPKGRMEPSPYLPTS
RRFVNPIYLRVEAIPEFADLGKRSRVRRLRADVQERAGRVDTIDRDSSWAAKRAALKLLH
EEPRSAGRELSYAAFRDREGRALDDFATWCALAEKYGDDWHCWPESLQHPDASGVADFVE
KHSDTVDFHRWLQWQIDEQLAAAQSQAIRAGMSLGIMGDLAVGVHPNGADTWALQDVMAL
GVTAGAPPDEFNQLGQDWSQPPWRPDRLDEHEYRPFRALIRAVLRHAGGVRIDHIIGLFR
LWWIPRGASPTEGTYVRYDHEAMIGIVALEAHRAGAVVVGEDLGTVEPWVRDYLLLRGLL
GTSILWFELDRDGNGGPLPAERWREYCLSSVTTHDLPPTAGYLAGDHVRLRDSLGLLTRP
VAEELESDRAELAAWLAELRRVGLLDEGEDDPQQVVLALYKYLGRTPSRLLGLALTDAVG
DRRTQNQPGTTDEYPNWRVPLTGPDGRDVLLEDVFTDPRAATLAEAVRAAIAPAASESSE
SVQSAAR
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaactcgcaccgtcgctgatcgaactcgcccggaggtacggcatcgcgacggag
tacgaggactggagcggcaggcgggtgcgggtgtcggaggcgacgctcaaggccgtgctg
gccgcgctcggcgtcgcggccgacgacgaacaggaacgcaacctcgcgctcaccgccaag
ctgcggtcgcactgggcgcggcggctgccggcgaccatcgtcggccgcaccggtgagcag
atccggttttgggcccacgtcacccatggtgctcccgccgaggtgtggttgacgctcgag
gacggcacggtgcgcggcgacgtcgcgcaggtcgacaacttcaccccgccgttcgacctg
gacggacgctgggtcggcgaggccagcttcctgctgcccaccgacctgccgctggggtat
caccgggtgcacctgcggtccggggactccgagaccagcaccgcgctgatcgtgacgccg
gattggctcgggctgccggagcggctcggcaaccgtcgcgcctggggcctggccgttcag
ctctacagcgtgcggtcccggcggtcctggggcgtcggcgatctcaccgatctgaccgac
ctcgcggtgtggtcggcgtcgcgccacggcgccgattaccttctggtcaatccgctgcat
gcggcggcgcctgcgggtccgaagggccggatggagccatcgccgtacctgccgacgtcg
cggcgcttcgtcaatccgatttatcttcgcgtcgaggcgatccccgaattcgccgacctg
ggcaagcgcagccgggtccgccggctgcgcgcggacgtccaggagcgcgccggccgcgtc
gacaccatcgaccgcgacagctcgtgggcggccaaacgggccgccctcaagctgctgcac
gaggaaccgcggtcggcgggccgggagctgtcgtacgcggcgttccgcgaccgggagggc
cgcgcgctcgacgacttcgcgacctggtgcgcgctggccgaaaaatacggcgatgactgg
cattgttggcccgaatcgctgcaacatcccgacgcgtccggggtcgcagactttgtcgaa
aaacattccgacacagtcgatttccaccgctggttgcaatggcaaatcgacgagcagctc
gccgcggcccagtcccaggcgatccgggccggaatgtcgttgggcatcatgggcgacctg
gccgtcggcgtgcaccccaacggcgccgacacctgggcgctgcaggatgtgatggcgctg
ggcgtgaccgccggggcgccaccggacgagttcaatcagctcggccaggactggtcgcag
ccgccgtggcggccggaccgactggacgagcacgagtaccggccgtttcgcgcgttgatc
cgcgcggtgctgcggcacgccggcggggtgcgcatcgaccacatcatcgggttgttccgg
ctctggtggatcccgcggggtgcatcacccaccgagggcacctacgtccgctacgaccac
gaagccatgatcggcatcgtcgccctggaggcacaccgggccggcgcggtggtggtgggc
gaggacctcggcacggtcgagccgtgggtgcgtgactacctgttgttgcgggggctgctg
ggcacgtcgatcctctggttcgagctggaccgcgacgggaacggcggaccactgccggcg
gagcgctggcgggagtactgcctgtcctcggtcaccacccacgacctgccgccgacggcc
ggctacctggcgggcgaccatgtgcggctgcgtgactcgctgggattgctgacccggccc
gtcgccgaggagctcgagtccgaccgtgccgagttggcggcgtggctggccgagttgcgc
cgggtggggctgctcgatgaaggcgaagacgacccgcagcaggtcgtcctggcgctgtac
aagtacctgggccggacgccgtcgcggctgctggggctggcgctcaccgacgccgtcggt
gaccgtcgcacccagaaccagcccggcaccacggacgaataccccaactggcgggtcccg
ctgaccggtccggacgggcgcgacgtgctgctcgaagacgtgttcaccgacccccgggcc
gccacgctggccgaggccgtgcgcgccgcgatcgccccggccgcctcggaaagctcggag
agcgttcaaagcgcggcccgctga

DBGET integrated database retrieval system