KEGG   Mycobacterium sp. MOTT36Y: W7S_14475Help
Entry
W7S_14475         CDS       T02113                                 

Definition
catechol-O-methyltransferase
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
mmm  Mycobacterium sp. MOTT36Y
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmm00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    W7S_14475
Enzymes [BR:mmm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     W7S_14475
Exosome [BR:mmm04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   W7S_14475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3182115..3182705
Genome map
AA seq 196 aa AA seqDB search
MLTTIDKFAYEKSMLINVGDEKGLLLDAAVRRADPALALELGTYCGYGALRIARAAPKAK
VFSVELAEANAANARQIWAHAGVADRVTCVVGTIGDGGRTLDALAEHGFAAGALDFVFID
HDKDAYLDDLKSILDRGWLHPGSIVVADNVRVPGAPKYRGYMHRHQGTRWNTVEHKTHLE
YQSLVSDLVLESEFLG
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
gtgctgacgaccatcgacaagttcgcctacgagaagtcgatgttgatcaacgtcggcgac
gagaagggactgctgctcgacgccgcggtgcggcgcgccgatccggcgctggcgctcgaa
ttgggcacctactgcggctacggcgcgctgcgcatcgcccgggccgcgccgaaggccaag
gtgttctcggtcgaactcgccgaggccaacgccgccaacgcccgccagatctgggcgcat
gccggcgtggccgaccgtgtgacctgtgtggtcggcaccatcggcgacggcggccgcacc
ctggatgcgctggccgaacacgggtttgccgctggcgcactcgatttcgtgttcatcgat
cacgacaaggacgcctacctcgacgacctgaagagcatcctggatcggggctggctgcat
ccgggctcgatcgtggtcgccgacaatgtgcgggtgccgggcgcaccgaagtaccgcggg
tacatgcaccggcatcagggcacgcggtggaacaccgtcgagcacaagacccacctcgag
taccaatcgttggtgtccgacctggtgctggagtccgaattcctgggctga

DBGET integrated database retrieval system