KEGG   Mycobacterium sp. MOTT36Y: W7S_14475Help
Entry
W7S_14475         CDS       T02113                                 

Definition
catechol-O-methyltransferase
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
mmm  Mycobacterium sp. MOTT36Y
Pathway
Tyrosine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:mmm00350]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3182115..3182705
Genome map
AA seq 196 aa AA seqDB search
MLTTIDKFAYEKSMLINVGDEKGLLLDAAVRRADPALALELGTYCGYGALRIARAAPKAK
VFSVELAEANAANARQIWAHAGVADRVTCVVGTIGDGGRTLDALAEHGFAAGALDFVFID
HDKDAYLDDLKSILDRGWLHPGSIVVADNVRVPGAPKYRGYMHRHQGTRWNTVEHKTHLE
YQSLVSDLVLESEFLG
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
gtgctgacgaccatcgacaagttcgcctacgagaagtcgatgttgatcaacgtcggcgac
gagaagggactgctgctcgacgccgcggtgcggcgcgccgatccggcgctggcgctcgaa
ttgggcacctactgcggctacggcgcgctgcgcatcgcccgggccgcgccgaaggccaag
gtgttctcggtcgaactcgccgaggccaacgccgccaacgcccgccagatctgggcgcat
gccggcgtggccgaccgtgtgacctgtgtggtcggcaccatcggcgacggcggccgcacc
ctggatgcgctggccgaacacgggtttgccgctggcgcactcgatttcgtgttcatcgat
cacgacaaggacgcctacctcgacgacctgaagagcatcctggatcggggctggctgcat
ccgggctcgatcgtggtcgccgacaatgtgcgggtgccgggcgcaccgaagtaccgcggg
tacatgcaccggcatcagggcacgcggtggaacaccgtcgagcacaagacccacctcgag
taccaatcgttggtgtccgacctggtgctggagtccgaattcctgggctga

DBGET integrated database retrieval system