KEGG   Mycobacterium sp. MOTT36Y: W7S_14840Help
Entry
W7S_14840         CDS       T02113                                 

Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
mmm  Mycobacterium sp. MOTT36Y
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:mmm03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3281252..3282037
Genome map
AA seq 261 aa AA seqDB search
MPELPDVEGFRRQLAASLPRRRIRHVQVHDPGILRNTTGQALARRLTGHRFADPRRHGKW
LVLPTDGPALLIHSGMTGRPYYAPDGAAHDPYERLVVSLDGGELRYADLRKLRGVWLADD
ADDIGHITGPQGPDALGLGLREFRAVLASRSARSRQLKPTLMDQSVLAGLGNLLVDEICW
RAKTRPTVAVADLGDDDVKALHAAMTRVLRTAVRHGRVPGLPRWLTRVRDEPDPRCPRCG
TRLERARVGGRATLWCPRCQP
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgagctgcccgacgtggaagggtttcggcggcaactggccgcgtccctgccgcgg
cggcgaatccggcacgtgcaggtgcacgatcccgggatcctgcgcaacaccaccggacaa
gcgctggcgcgccggttgaccggtcaccgcttcgcggacccacgccggcacggcaagtgg
ttggtgctccccaccgacggcccggcgctgctgatccacagcggcatgaccggccggccc
tactatgcccccgacggggccgcccacgacccctacgagcggctggtggtgtcgctggac
gggggcgagctgcgctacgccgacctccgcaaattgcgcggggtgtggctggccgacgat
gccgacgacatcgggcacatcaccggcccgcagggacccgacgcgttgggtctcggcctg
cgcgagttccgcgcggtgctggcctcgcggtcggcccgctcgcggcagctcaaacccacg
ctgatggaccagtcggtgctcgccggcctcggcaacctgctggtcgacgagatctgttgg
cgggccaaaacccgaccgaccgtggcggtcgcggacttgggcgacgacgacgtaaaggcc
ttgcacgccgcgatgacccgggtgctgcgcaccgcggtgcgccacggccgggtgcccggc
ctgccgcgctggctcaccagggtgcgtgacgagcccgacccgcgctgcccccgctgtggg
acgcggctcgagcgcgcccgggtgggcggacgggcgacgctgtggtgtccgcgctgccag
ccgtag

DBGET integrated database retrieval system