KEGG   Mycobacterium sp. MOTT36Y: W7S_14955Help
Entry
W7S_14955         CDS       T02113                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mmm  Mycobacterium sp. MOTT36Y
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mmm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    W7S_14955 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    W7S_14955 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    W7S_14955 (trpA)
Enzymes [BR:mmm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     W7S_14955 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3308196..3309011)
Genome map
AA seq 271 aa AA seqDB search
MTVKQSEASRLGPIFDVCRDDGRAALIGYLPTGYPDVTTSVHAMVALVESGCDIVEVGVP
YSDPGMDGPTIAKATEAALHGGVRVRDTLAAVEAISAAGGHAVVMTYWNPVLRYGIDAFA
RDLASAGGYGLITPDLIPDEAGQWLAASEEHRLDRIFLVAPSSTPQRLAMTVEASRGFVY
AASTMGVTGARDVVSNAAPELVGRVKEISDIPVGVGLGVRSGEQAAQIGGYADGVIVGSA
LVSALGDGGLTALRALTEELAAGVRQRAAAS
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtgaagcagagcgaggccagcaggctcgggccgatcttcgacgtgtgccgcgac
gacggtcgcgccgcgctgatcggctatctgcccaccgggtacccggatgtgacgacgtcc
gtgcacgcgatggtcgccctggtcgaatccggttgcgacatcgtcgaggtcggggtgccc
tattcggatcccggcatggacggcccgaccatcgccaaggccaccgaggccgcgctgcac
gggggagtgcgcgtccgcgacaccctggccgcggtcgaggcgatcagcgccgccgggggc
cacgccgtggtgatgacctactggaaccccgtgttgcgctacggaattgacgccttcgcc
cgcgacctggcatcggccggcgggtacggcctgatcactccggacctcatccccgacgaa
gccgggcagtggttggcggcgtccgaggagcatcggttggaccggatatttctggtggcg
ccctcctcgacgccgcagcgcttggcgatgacggtcgaggcgtcccgcggatttgtctac
gcggcgtcgacgatgggcgtcacgggagcacgcgacgtggtgtccaatgccgcgcccgaa
ttggtgggcagggtcaaggagatatcggacatccccgtcggtgtcgggctgggggtgcgg
tcgggtgagcaagccgcccagatcggcggctacgccgacggtgtcattgtcggttccgcg
ctggtgtcggcgctgggggacgggggtttgaccgcattgcgcgcactcactgaggaactc
gccgccggtgtacgtcaaagggcggccgcgtcgtga

DBGET integrated database retrieval system