KEGG   Mycobacterium sp. MOTT36Y: W7S_14960Help
Entry
W7S_14960         CDS       T02113                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mmm  Mycobacterium sp. MOTT36Y
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mmm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    W7S_14960
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    W7S_14960
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    W7S_14960
Enzymes [BR:mmm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     W7S_14960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3309008..3310267)
Genome map
AA seq 419 aa AA seqDB search
MVDLSRPDLPLPSAAIAEPTRHEPDAGGHFGVYGGRYVAEALMAVIEEVTAAYEKERVNQ
DFLDTLDYLQAHYAGRPSPLYEAPRLSEQAGARIFLKREDLNHTGSHKINNVLGQALLAQ
RMGKKRVIAETGAGQHGVATATACALLGLECVIYMGAVDTERQALNVARMRLLGATVVSV
QSGSRTLKDAINEAFRDWVTNADNTFYCFGTAAGPHPFPAMVRDFQRIIGLEARAQIQAQ
AGRLPDAVLACIGGGSNAIGIFHPFIDDPGVRLIGFEAAGDGVETGRHAATFSGGSPGAF
QGSFSYLLQDSDGQTIESHSISAGLDYPGVGPEHAWLRESGRAEYRPITDSEAMEAFRTL
CRTEGIIPAIESAHAVAGALKVAPELGKAAIIVVNLSGRGDKDVETAAQWFGLLGSSDR
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggtggatctgtcccgcccggaccttccgcttccgagcgcagccatcgccgaacccacc
cgccacgaacccgatgcgggtggccatttcggtgtgtacggcggccgctacgtcgccgag
gcgttgatggccgtgatcgaagaggtcaccgcggcctacgagaaggagcgcgtcaaccag
gatttcctggacacgctggactatctgcaggcgcattacgcggggcggccgtcaccgctg
tatgaggcgccgcggctgtccgagcaggccggcgcccgcatcttcctcaagcgagaagac
ctgaaccacaccggttctcacaagatcaacaacgtgctcggccaggcgctgctcgctcag
cggatgggcaagaagcgggtgatcgccgagaccggggccggtcagcacggcgtggcgacc
gccaccgcgtgcgccctgctcggcctggagtgtgtgatctacatgggcgccgtcgacacc
gaacgccaggcgctcaacgtggcccggatgcgcttgctgggagccacggtcgtctcggtc
cagagcggttcgaggacgctcaaggacgccatcaatgaagcgttccgggattgggttacc
aatgccgacaacaccttctactgcttcggcacggcggcggggccccatccctttcccgcc
atggtgcgcgactttcagcgcatcatcggcctcgaggcgcgcgcccagatccaggcgcag
gcgggccggctgcccgacgcggtgctggcctgcatcggtggcggatcgaacgccatcggc
atcttccacccgttcatcgacgatcccggcgtgcggctgatcggcttcgaggcggccggc
gacggcgtcgaaaccggaaggcacgccgcgaccttcagcggcggttcccccggggcgttc
cagggatcgttctcctacctgctgcaggactccgacgggcagaccatcgaatcccattcc
atctcagcgggtctcgactacccgggggtgggtccggaacacgcgtggctgcgcgagagc
ggacgcgccgagtaccggcccatcaccgactccgaagcgatggaggcattccgcaccctg
tgccgcaccgaggggatcatccccgccatcgaatccgcgcacgcggtggccggggccctg
aaggtggcccccgaattggggaaggccgcgatcatcgtggtgaacctgtccggccgcggg
gacaaggacgtcgagacggccgcgcagtggttcgggctgttgggatccagcgaccgatga

DBGET integrated database retrieval system