KEGG   Mycobacterium sp. MOTT36Y: W7S_14960Help
Entry
W7S_14960         CDS       T02113                                 

Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mmm  Mycobacterium sp. MOTT36Y
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mmm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    W7S_14960
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    W7S_14960
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    W7S_14960
Enzymes [BR:mmm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     W7S_14960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3309008..3310267)
Genome map
AA seq 419 aa AA seqDB search
MVDLSRPDLPLPSAAIAEPTRHEPDAGGHFGVYGGRYVAEALMAVIEEVTAAYEKERVNQ
DFLDTLDYLQAHYAGRPSPLYEAPRLSEQAGARIFLKREDLNHTGSHKINNVLGQALLAQ
RMGKKRVIAETGAGQHGVATATACALLGLECVIYMGAVDTERQALNVARMRLLGATVVSV
QSGSRTLKDAINEAFRDWVTNADNTFYCFGTAAGPHPFPAMVRDFQRIIGLEARAQIQAQ
AGRLPDAVLACIGGGSNAIGIFHPFIDDPGVRLIGFEAAGDGVETGRHAATFSGGSPGAF
QGSFSYLLQDSDGQTIESHSISAGLDYPGVGPEHAWLRESGRAEYRPITDSEAMEAFRTL
CRTEGIIPAIESAHAVAGALKVAPELGKAAIIVVNLSGRGDKDVETAAQWFGLLGSSDR
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggtggatctgtcccgcccggaccttccgcttccgagcgcagccatcgccgaacccacc
cgccacgaacccgatgcgggtggccatttcggtgtgtacggcggccgctacgtcgccgag
gcgttgatggccgtgatcgaagaggtcaccgcggcctacgagaaggagcgcgtcaaccag
gatttcctggacacgctggactatctgcaggcgcattacgcggggcggccgtcaccgctg
tatgaggcgccgcggctgtccgagcaggccggcgcccgcatcttcctcaagcgagaagac
ctgaaccacaccggttctcacaagatcaacaacgtgctcggccaggcgctgctcgctcag
cggatgggcaagaagcgggtgatcgccgagaccggggccggtcagcacggcgtggcgacc
gccaccgcgtgcgccctgctcggcctggagtgtgtgatctacatgggcgccgtcgacacc
gaacgccaggcgctcaacgtggcccggatgcgcttgctgggagccacggtcgtctcggtc
cagagcggttcgaggacgctcaaggacgccatcaatgaagcgttccgggattgggttacc
aatgccgacaacaccttctactgcttcggcacggcggcggggccccatccctttcccgcc
atggtgcgcgactttcagcgcatcatcggcctcgaggcgcgcgcccagatccaggcgcag
gcgggccggctgcccgacgcggtgctggcctgcatcggtggcggatcgaacgccatcggc
atcttccacccgttcatcgacgatcccggcgtgcggctgatcggcttcgaggcggccggc
gacggcgtcgaaaccggaaggcacgccgcgaccttcagcggcggttcccccggggcgttc
cagggatcgttctcctacctgctgcaggactccgacgggcagaccatcgaatcccattcc
atctcagcgggtctcgactacccgggggtgggtccggaacacgcgtggctgcgcgagagc
ggacgcgccgagtaccggcccatcaccgactccgaagcgatggaggcattccgcaccctg
tgccgcaccgaggggatcatccccgccatcgaatccgcgcacgcggtggccggggccctg
aaggtggcccccgaattggggaaggccgcgatcatcgtggtgaacctgtccggccgcggg
gacaaggacgtcgagacggccgcgcagtggttcgggctgttgggatccagcgaccgatga

DBGET integrated database retrieval system