KEGG   Mycobacterium sp. MOTT36Y: W7S_14965Help
Entry
W7S_14965         CDS       T02113                                 

Gene name
trpC
Definition
Indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
mmm  Mycobacterium sp. MOTT36Y
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mmm01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:mmm00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3310341..3311159)
Genome map
AA seq 272 aa AA seqDB search
MSPATVLDSILEGVRADVAAREALISLSEIKAAAAAAPPPRDVMAALREPGIGVIAEVKR
ASPSAGSLATIADPAKLARAYEDGGARIISVLTEERRFHGSLDDLDAVRAAVSIPILRKD
FVVQPYQIHEARAHGADMLLLIVAALEQSALVSMLDRTESLGMTALVEVHTEEEADRALK
AGANVIGVNARDLATLAVDRDCFARIAPGLPSNVIRIAESGVRGTADLLAYAGAGADAVL
VGEGLVKSGDPRAAVADLVTAGTHPSCPKPSR
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgagtccggcaaccgtgcttgactccatcctcgagggagtccgggccgacgttgccgcg
cgcgaagccctcatcagcctgtccgagatcaaggccgccgcggcggccgcgccgccgccc
cgcgacgtgatggccgccctgcgcgagcccggaatcggcgtcatcgccgaagtcaagcgc
gccagcccgtcggcgggttccctggcgaccattgccgatccggccaaactggccagggcg
tacgaggacggcggcgcgcgcatcatcagcgtcttgaccgaggagcgccgctttcacggt
tcgctcgacgatctcgacgcggttcgggcggcggtctcgataccgattttgcgcaaagac
tttgtggtgcagccctatcagatccacgaagcgcgtgcgcacggcgccgacatgttgttg
ctcatcgtcgccgcgctggagcagtcggcgttggtgtcgatgctggaccgcaccgaatcg
ctgggcatgacggcactcgtcgaggtgcacaccgaagaggaggccgaccgcgcgctcaag
gccggggccaacgtaatcggcgtcaacgcccgcgatctggccacgctggcggtggaccgg
gattgcttcgcgcgcatcgctcccgggctgcccagcaacgtgatcaggatcgccgaatcc
ggtgtgcgcggtaccgcagacctgctggcgtacgccggtgcgggtgccgacgccgtgttg
gtgggcgaaggtctggtcaaaagtggtgacccgcgcgccgcggtcgccgatctggtcacc
gcgggcacccatccgtcctgtccgaaaccttctcgctag

DBGET integrated database retrieval system