KEGG   Mycobacterium sp. MOTT36Y: W7S_16450Help
Entry
W7S_16450         CDS       T02113                                 

Definition
class II aldolase/adducin domain-containing protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mmm  Mycobacterium sp. MOTT36Y
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mmm00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    W7S_16450
Enzymes [BR:mmm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     W7S_16450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3683371..3684168)
Genome map
AA seq 265 aa AA seqDB search
MASTFTDSKSDLMRRAAEQLTALQSKDAADAPLTTRQKLALTCRALFDAGHDSGLAGQIT
ARAERDGTYYTQRLGLGFDEITDANLLLVDEDLNVLEGDGIANPANRFHSWIYRARPDVQ
CIVHTHAFHVAALSMLEVPLIVSHMDTTPLYGDCAFLEKWPGVPVGNEEGEIISAALGDK
KAVLLAHHGHVIAGASVEEACSLGILIERAAKLQLAAMAAGTVKELPEELAREAHDWTLS
PQRSRANFAYYARRALARHPDALTS
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggccagcacgttcaccgattcgaaatccgacttgatgcgccgcgcggccgagcagttg
acggcccttcaatccaaggacgccgccgatgcgccgctgaccacccgccagaagctcgcc
ctgacgtgccgcgccctgttcgacgccgggcacgattccgggttggccgggcagatcacc
gcccgcgccgagcgggacggcacctactacacccagcggctcggtctgggcttcgacgag
atcaccgacgccaacctgcttttggtcgacgaggacctcaacgtccttgagggagacgga
atcgccaaccccgccaaccgctttcacagctggatctatcgcgcccgccccgatgtgcaa
tgcatcgtgcacacgcacgcgttccacgtggccgcgctgtcgatgctggaagttccgctg
atcgtgtcccacatggacaccacgccgctctacggcgactgcgcgttcctggagaaatgg
cccggcgtgccggtcggcaacgaggagggggagatcatctccgccgcgctgggggacaag
aaggcggtcctgctggcccaccacggccacgtcatcgccggcgccagcgtcgaggaggcg
tgctcgttgggcatcctcatcgagcgcgccgcgaaactgcagctggccgcgatggccgcc
ggcaccgtcaaagagctacccgaggagctggcccgcgaggcccacgactggacactgtcg
ccgcagcgcagccgcgccaacttcgcctactacgcccgccgggccctggcccggcacccg
gacgcgctgaccagctaa

DBGET integrated database retrieval system