KEGG   Mycobacterium sp. MOTT36Y: W7S_17390Help
Entry
W7S_17390         CDS       T02113                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
mmm  Mycobacterium sp. MOTT36Y
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mmm00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:mmm00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3855881..3856366)
Genome map
AA seq 161 aa AA seqDB search
MGLVWAQSTSGVIGRGGGIPWNVPEDLARFKEVTIGHTVVMGRRTWDSLPAKVRPLPGRR
NVVLSREDGFAADGAQVVGSLDAAFARAEGEPAVWVIGGGQVYLAALPYATRCEVTEIEL
DLRRDDDDALAPALDDTWVGETGEWQASRSGLRYRFHSYRR
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
gtgggcctggtgtgggcccagtcgacctccggcgtcatcgggcgcggtggcggcatcccc
tggaacgtgccggaagacctcgcccggttcaaagaggtgacgatcgggcacaccgtggtg
atgggccggcggacctgggactcgttgccggccaaggtgcggccgctacccggccggcgc
aacgtcgtgctgtcccgcgaggacggcttcgccgccgacggggcgcaggtggtcggctca
ctggacgcggccttcgcccgggccgagggggagcccgcggtctgggtgatcggcggcggg
caggtgtatctggccgcgttgccgtacgccacccggtgcgaggtcaccgagatcgagctc
gacttgcgccgcgacgacgacgacgcgctggcgcccgccctggacgacacctgggtgggc
gagacgggggagtggcaggccagccgctccgggctgcggtaccgcttccacagctaccgt
cgctga

DBGET integrated database retrieval system