KEGG   Mycobacterium sp. MOTT36Y: W7S_18520Help
Entry
W7S_18520         CDS       T02113                                 

Definition
glycoside hydrolase
Orthology
K16150  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
mmm  Mycobacterium sp. MOTT36Y
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:mmm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    W7S_18520
Enzymes [BR:mmm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     W7S_18520
Glycosyltransferases [BR:mmm01003]
 Polysaccharide
  Storage polysaccharide
   W7S_18520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4096282..4097526
Genome map
AA seq 414 aa AA seqDB search
MKILMVSWEYPPVVVGGLGRHVHHLSTALAAAGHDVVVLSRRPTGTDPRSHPSSDQISEG
VRVIAAAQDPHEFTFGTDMMAWTLAMGHSMVRAGLSLKKPGSSHAWRPDVVHAHDWLVAH
PAIALAQFYDVPMVSTIHATEAGRHSGWVSGALSRQVHAVESWLVRESDSLITCSGSMAD
EITELFGPGLAEITVICNGIETARWPFAARRPRTGPAELLYLGRLEYEKGVHDVIAALPR
VRRTHAGTTLTIAGEGTQQGWLIEQARKHRVLKAIRFVGHLEHAELLAVLHRADAAVLPS
HYEPFGIVALEAAAAGTPLVTSNIGGLGEAVIDGRTGVSCPPRDVTRLAAAIRTVLDDPR
AAQQRARAARERLTSDFDWRTVADKTAQVYLSAKRGERQPQARLPIVEHALPDR
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
gtgaagatcctgatggtgtcgtgggagtacccgccggtggtcgtcggcgggctcggccgg
cacgtccatcacctgtccaccgcgctggcggccgcaggtcacgacgtcgtggtgctgtca
cgccgacccaccgggaccgatccccgcagccatccgtcgtccgaccagatcagcgagggt
gttcgggtgatcgcggccgcgcaggatccgcacgagttcaccttcggcaccgacatgatg
gcctggacgcttgcgatggggcattccatggtccgcgccgggctgagcctgaagaaaccg
ggcagcagccacgcgtggcggcccgacgtcgtgcacgcccacgactggctggtggcccat
ccggcgatcgcgctggcccaattctatgacgtgccaatggtttccacgatccatgcgacc
gaggccggtcggcattccggctgggtcagcggcgcgctcagccgtcaggtgcacgcggtc
gagtcctggctggtgcgcgaatccgattcgctgatcacgtgttcggggtcgatggccgac
gagatcaccgaactgttcggtccggggctggcggagatcaccgtgatctgcaacggcatc
gagacggcgcggtggccgttcgcggcgcggcggccgcgcacgggtccggccgaactgctc
tacctggggcggctggagtacgagaagggggtgcacgacgtcatcgccgcgctcccgcgg
gtcaggcgcacccacgcgggcaccacgctgaccatcgccggcgagggcacccagcagggc
tggctcatcgagcaagcccgtaaacaccgggtgctcaaggcgattcggttcgtcgggcac
ctcgagcacgcggagctgttggccgtactgcatcgcgccgacgccgcggtgttgcccagc
cactacgagccgttcggcatcgtggcgctcgaggcggccgcggccggcactcccctggtg
acgtcgaacatcggcggtctgggtgaggcggtgatcgacggtcggaccggcgtatcgtgc
ccgccccgcgacgtgacccggctggccgcggcgattcgcaccgtcctcgacgatccgcgc
gccgcgcaacaacgcgcccgggccgcccgcgaacgcctcacgtccgacttcgattggcgt
acggtggccgacaagaccgcgcaggtctatctgtcggccaagcgcggcgagcggcagccg
caggcgcggctccccatcgtcgaacacgccttgccggaccggtag

DBGET integrated database retrieval system