KEGG   Mycobacterium sp. MOTT36Y: W7S_20780Help
Entry
W7S_20780         CDS       T02113                                 

Definition
succinate dehydrogenase hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
mmm  Mycobacterium sp. MOTT36Y
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mmm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    W7S_20780
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    W7S_20780
   00650 Butanoate metabolism
    W7S_20780
  Energy metabolism
   00190 Oxidative phosphorylation
    W7S_20780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4547763..4548233
Genome map
AA seq 156 aa AA seqDB search
MSSPDLQLTRGQTAPVKQRSYDRPASLDNPRSPRRRAGIPNFEKFAWLFMRFSGIALFVL
AIGHLFIMLMWDNGVYRIDFNYVAQRWASPFWQFWDLALLWLAQLHGGNGLRTIIDDYSR
KDSTRFWLNSLLLLSMGFTLVLGTYVLLTFDPNIHA
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgagcagccccgaccttcagctgacccgcggccagacggcgccggtcaaacaacgcagc
tacgaccggcccgccagcctggacaatccccgctcgccgcggcgccgggccggcatcccc
aacttcgagaagttcgcctggctgttcatgcggttctcgggcatcgcgctgttcgtgctg
gcgatcggccacctgttcatcatgctgatgtgggacaacggcgtgtaccgcatcgacttc
aactatgtggcgcagcgctgggcgtcgccgttctggcaattctgggacctcgcgctgcta
tggctggcgcagctgcacggcggcaacggcctgcgcacgatcatcgacgactacagccgc
aaggacagcacccggttctggctcaacagcctgctgttgctgtcgatggggttcacgttg
gtgctgggcacctacgtgctgctgacgttcgaccccaacattcacgcctga

DBGET integrated database retrieval system