KEGG   Mycobacterium sp. MOTT36Y: W7S_21155Help
Entry
W7S_21155         CDS       T02113                                 

Definition
FAD dependent oxidoreductase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
mmm  Mycobacterium sp. MOTT36Y
Pathway
Steroid degradation
Brite
KEGG Orthology (KO) [BR:mmm00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    W7S_21155
Enzymes [BR:mmm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     W7S_21155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4633998..4635746)
Genome map
AA seq 582 aa AA seqDB search
MKPDYDVLIIGSGFGGSVSALRLTEKGYRVGVLEAGRRFADEDFAETSWDLRKFLWAPKL
GCYGIQRIHPLRNVLILAGAGVGGGSLNYANTLYVPPEPFFKDQQWSHITDWRDELMPHY
DQARRMLGVVENPTFTDADRVVKEVADDMGCGDTFVPTPVGVFFGPDGTKAPGKTVPDPY
FGGAGPERTGCLECGCCMTGCRYGAKNTLLKNYLYLAESGGAQVIPMTTVKRFEQRPDGL
WEVRTVRTGSWLRRDRRTYTAKHLILAAGTWGTQHLLFKMRDEGRLPRLSNRLGVLTRTN
SESIVGAGRLEVSPDLDLTHGVAITSSIHPTPDTHIEPVRYGKGSNAMGLLQTLMTDGPP
GPGGPDGTFVPRWKQLLDTARADPRGMLRLLNPRQWSERTMIALVMQHLDNSITTFTKRG
KLGIRWYTSKQGHGEPNPTWIPVGNEVTRRIAAKIDGVAGGTWGELLNIPLTAHFLGGAV
IGDNVDHGVIDPYHRVYGYPTLYVVDGAAISANLGVNPSLSITAQAERAASLWPNNGEND
RRPAQGEPYRRLDPIAPAHPRVPLSAPGALRWSPVDPVSSVS
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgaagccggattacgacgtactgatcatcggttcgggttttgggggcagcgtcagcgcg
ttgcggctgacggaaaagggctaccgcgtcggcgtcctcgaggccggacgccggttcgcc
gacgaggatttcgccgagacgtcctgggatctgcgcaagttcctatgggcgccgaagctg
ggttgctacggcatccagcgcatccacccgctgcgcaacgtgctgatcctggccggcgcc
ggcgtgggcggcggctcgctgaactacgccaacacgctgtatgtgccgcccgagccgttc
ttcaaagaccagcagtggtcgcacatcaccgactggcgcgacgagctgatgccgcactac
gaccaggcgcgacgcatgctgggcgtggtggagaacccgaccttcaccgatgccgatcgc
gtcgtcaaggaggtcgccgacgacatgggctgcggtgacacgttcgtgccgacgccggtc
ggggtgttcttcggccccgacggcaccaaggcgccgggcaagaccgtgccggacccctac
ttcggcggagccggacccgagcgcaccggctgcctggagtgcggctgctgcatgaccggg
tgccgctacggcgccaagaacaccctgctgaagaactacctctatctcgcggaatcgggt
ggggcgcaagtcattccgatgacgacggtgaagcggttcgagcagcggcccgacgggctg
tgggaggtccgcacggtgcgcaccggcagttggctgcgccgcgaccggcgcacctacacc
gccaagcacctgatcctggccgccgggacgtggggcacccagcacctgctgttcaagatg
cgcgacgagggccggctgccccggctctccaaccgcctcggcgtgctgacccgcaccaac
tccgagtccatcgtcggggccgggcgcctggaggtctctccggatctggacctcacccac
ggggtggcgatcacgtcgtcgatccacccgacgcccgacacccacatcgagccggtccgc
tacggcaagggttccaacgcgatggggctgctgcagacgttgatgaccgacggaccccct
gggcccggagggcccgatgggacgttcgtgccccgctggaagcagttgctggacaccgcc
cgtgcggatccgcgcggaatgctgcggctgctcaacccacgccagtggagtgagcggacc
atgatcgcgctggtgatgcagcacctggacaattcgatcacgacgttcaccaaacgcggc
aagctcggcatccgctggtacaccagcaagcagggccacggcgagccgaacccgacgtgg
atcccggtgggcaacgaggtcacccgccgcatcgccgccaagatcgacggcgtggccggc
ggcacctggggcgagctgctcaacatcccgctgaccgcgcacttcctcggcggcgcggtg
atcggcgacaacgtcgaccacggggtcatcgacccctatcaccgggtctacggctacccg
accctgtatgtggtggacggcgcggcgatctcggcgaacctgggcgtgaatccgtcgctg
tccatcaccgcccaggccgagcgggccgcgtcgctgtggccgaacaacggcgaaaacgac
cggcggcctgcgcagggcgagccgtatcgccggctggatccgatagcgccggcgcacccg
cgggtgcccctctccgccccgggcgcgctgcgctggtcaccggtcgatccggtcagctcg
gtctcgtga

DBGET integrated database retrieval system