KEGG   Mycobacterium sp. MOTT36Y: W7S_21465Help
Entry
W7S_21465         CDS       T02113                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
mmm  Mycobacterium sp. MOTT36Y
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:mmm00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:mmm00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4692440..4693069
Genome map
AA seq 209 aa AA seqDB search
MGSDVEVRELKVPGAWEITPAVHGDSRGHFFEWLTDKGFRSFAGHRLEVRQANCSVSSAG
VLRGLHFAQVPPSQAKYVTCVRGAVFDVVVDIRVGSPTFGQWDSVLLDDTEHRTIYLSEG
LGHGFLALQDNSTVMYLCSAEYNPQREHTICATDPALGIDWPLVDGAPPTLSDRDAAAPS
LDDVRASGLLPTWEETNAFVEGLRAKPAN
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
gtgggcagtgacgtggaagttcgcgagctgaaagttcccggcgcctgggagatcaccccc
gccgttcatggcgattcgcggggccatttcttcgaatggctgaccgacaagggattcagg
tccttcgccggtcaccggctggaggttcggcaggccaattgctcggtgtcatcggccggc
gtgctgcgcggcctgcacttcgcccaggtaccgccgagccaggccaagtacgtgacctgc
gtgcgcggggcggtattcgacgtcgtcgtcgacatccgggtgggctcaccgacattcggt
cagtgggactcggtgctgctcgacgacaccgagcacaggacgatctacctctccgagggc
ctcggacacggtttcctggcgctgcaagacaattcgacggtgatgtacttgtgctcggcg
gaatacaacccgcaacgcgaacacaccatttgcgcaaccgatccggcgctggggatcgat
tggcctctggtggacggcgcgccgcccaccctgtccgaccgcgacgcggcggcccccagc
ctcgacgacgtacgcgcctccggcctgctccccacctgggaggagacgaacgcgttcgtc
gagggtttgcgggcaaagcccgcgaattga

DBGET integrated database retrieval system