KEGG   Mycobacterium sp. MOTT36Y: W7S_22115Help
Entry
W7S_22115         CDS       T02113                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mmm  Mycobacterium sp. MOTT36Y
Pathway
mmm00071  Fatty acid degradation
mmm00280  Valine, leucine and isoleucine degradation
mmm00281  Geraniol degradation
mmm00310  Lysine degradation
mmm00360  Phenylalanine metabolism
mmm00362  Benzoate degradation
mmm00380  Tryptophan metabolism
mmm00410  beta-Alanine metabolism
mmm00627  Aminobenzoate degradation
mmm00640  Propanoate metabolism
mmm00650  Butanoate metabolism
mmm00903  Limonene and pinene degradation
mmm00930  Caprolactam degradation
mmm01100  Metabolic pathways
mmm01110  Biosynthesis of secondary metabolites
mmm01120  Microbial metabolism in diverse environments
mmm01130  Biosynthesis of antibiotics
mmm01212  Fatty acid metabolism
Module
mmm_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mmm00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    W7S_22115
   00650 Butanoate metabolism
    W7S_22115
  Lipid metabolism
   00071 Fatty acid degradation
    W7S_22115
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    W7S_22115
   00310 Lysine degradation
    W7S_22115
   00360 Phenylalanine metabolism
    W7S_22115
   00380 Tryptophan metabolism
    W7S_22115
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    W7S_22115
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    W7S_22115
   00281 Geraniol degradation
    W7S_22115
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    W7S_22115
   00627 Aminobenzoate degradation
    W7S_22115
   00930 Caprolactam degradation
    W7S_22115
Enzymes [BR:mmm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     W7S_22115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AFJ37372
UniProt: I2AJ98
Position
complement(4814449..4815216)
Genome map
AA seq 255 aa AA seqDB search
MSDPVRVERNGRVTTVIIDRPGARNAVNGPTAAALYAAFEEFDRDDTASVAVLWGDGGTF
CAGADLKAFGTPDANAVHRSGPGPMGPTRMVLSKPVIAAVSGYAVAGGLELAIWCDLRVV
EEDAVFGVFCRRWGVPLIDGGTVRLPRLIGHSRAMDMILTGRAVAADEAQAIGLANRVVP
KGQSRRAAEELAAQLSALPQQCLRSDRLSALHQWGATESEALDFEFASISRVAAEANEGA
GRFAAGAGRHGAAAD
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatccggtgcgcgtcgagcgcaacggccgggtgaccaccgtgatcatcgaccgg
ccgggggcgcgcaacgcggtcaacggcccgacggccgccgcgctctatgcggcgttcgag
gagttcgaccgcgacgacaccgcgtcggtcgccgtgctgtggggcgacggcggaacattc
tgcgccggagccgatttgaaggcgttcggcacacccgacgccaacgccgtgcaccggagt
ggcccgggcccgatgggcccgacgcggatggtgctgtccaagcccgtcatcgccgcggtc
agcggctacgccgtcgccggcggcctcgagttggccatctggtgtgatctgcgggtggtc
gaggaggacgccgtgttcggggtgttctgccggcgctggggcgttcccctgatcgatggg
ggcaccgtgcggctgccgcgcctgatcggccacagccgcgcgatggacatgatcctcacc
ggccgcgccgtggccgccgacgaagcccaggccatcgggctggcgaaccgagtggtcccc
aagggccaatcgcgccgggccgcagaggaattggcggcacaactgtcggcactgccgcag
cagtgcctgcgctcggaccggctctcggcgctacaccaatggggggcaacggaatccgag
gcgctcgacttcgaattcgccagcatctcccgggtggccgcggaggcgaacgaaggggcc
gggcggttcgccgccggcgcggggcgtcacggcgcggccgccgattga

DBGET integrated database retrieval system