KEGG   Mycobacterium sp. MOTT36Y: W7S_22345Help
Entry
W7S_22345         CDS       T02113                                 

Definition
hypothetical protein
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
mmm  Mycobacterium sp. MOTT36Y
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mmm00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    W7S_22345
Enzymes [BR:mmm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     W7S_22345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4868086..4869792
Genome map
AA seq 568 aa AA seqDB search
MFATGLLRTFSDAGVFEAADVHVAQRLTALTGESDERVALAVALVVRALRGGSVCVDLRA
TPGLLGDAELPWPGADDWLAAVQASALLGPPPVLRFFGDLLYFDRYWLEEEQVCTDLLAL
SASPVGIESSSYERLFEPGYEEQRAAAEIAVSQAVTVLTGGPGTGKTTTIARLLALLLEH
AERAGMPPPRIALAAPTGKAAARLAEAVAAGARRLGAADRARLAGLSGTTLHRLLGPRPD
TSVRFKHNRANRLPHDVIVVDETSMVSLTMMARLAEAVRPDSRLILVGDPDQLASVEAGA
VLADLVDGLSARGDVRVAALRTPHRYGTSIGALAEAIRVGDADRVVELLAAGGEHVEWVD
AQRPADRLREVLVAHALRLRSAALLGAADEALATLDEHRLLCAHREGPYGATHWNTLVQK
WIAEATGQPAWSQWYAGRPLLVTANDYGLRLYNGDTGVAVAGAEGLRAVIAGASGPLDFA
TSRLGEVETMHAMTIHKSQGSQADEVTVLIPPEDSRLLTRELFYTAVTRAQTRVRVVGPE
ASVRAAIERRAMRATGLRQRLRADAAAT
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgttcgcgaccggattgctgcgcacgttcagcgatgccggcgtcttcgaggcggcggac
gtgcatgtggcgcaacggcttaccgcgctcaccggcgagtccgacgaacgggtcgccctg
gcggtcgcgctggtggtgcgcgcgctgcggggcggttcggtctgcgtcgatctccgcgcc
acgcccgggctgctcggcgacgccgagctgccgtggcccggcgccgacgactggctggcg
gcggtgcaggccagcgcgttactcgggccgccgccggtgctgcggtttttcggcgatctg
ctgtacttcgaccggtactggctcgaggaggagcaggtgtgcaccgacctgctggccctg
tcggcgtcgccggtcggcatcgaatcgtccagttacgaacggcttttcgagcccgggtac
gaggagcagcgggccgccgccgaaatcgcggtgtcgcaggcggtgaccgtgctgaccggc
ggccccggcaccggcaagaccaccacgatcgcgcggctgctcgccctgctcctcgagcat
gccgagcgggccgggatgccgccgccccggatcgcgctggccgcaccgaccggcaaggcg
gcggcgcggctggccgaggcggtggccgcgggagcccgccggctcggcgcggccgaccgg
gcgcggctggccggcctgtccgggaccacgctgcaccggctgctgggtccccggccggat
acgtcggtgcggttcaagcacaatcgcgccaaccggctgccgcacgacgtcatcgtggtg
gacgagacgtcgatggtgtcgttgacgatgatggcccggctggccgaagcggtccgcccg
gactcccggttgattctggtcggcgacccggaccagttggcctcggtggaggcgggcgcc
gtgctggccgacctggtggacgggctgtccgcccgcggcgacgtgcgggtggccgccctg
cgcacgccgcaccgatacggcacgtcgatcggcgcgctggccgaggcgatccgggtcggc
gacgcggaccgggtggtggagctgctggcggccgggggcgagcacgtcgagtgggtggat
gcacagcgcccggccgatcggctgcgcgaggtgctcgtcgcgcacgcgctgcggctgcgg
tcggccgcgctgctgggcgcggccgacgaggcgctggccacgctggacgaacaccggctg
ctgtgcgcgcaccgcgagggcccgtacggggcgacgcactggaacacgttggtgcagaag
tggattgccgaggcgacggggcagccggcatggtcgcagtggtacgccgggcgcccgctg
ctggtgaccgccaacgactacggcctgcggctctacaacggcgacaccggtgtggcggtg
gccggcgcggagggcctgcgggcggtcatcgccggtgccagcgggccgctagacttcgcg
accagccgtctcggcgaggtggagacgatgcacgccatgaccatccacaagagtcagggc
agccaggccgacgaggtgaccgtgctgataccgccggaggattcgcgactgctgacgcgg
gaactgttctacacggccgtcacccgggcgcagaccagggtgcgggtggtcgggcccgag
gcctcggtgcgcgcggcgatcgagcgccgggcgatgcgggccaccggattgcggcaacgg
ctgcgggccgacgccgccgcgacgtga

DBGET integrated database retrieval system