KEGG   Mycobacterium sp. MOTT36Y: W7S_22780Help
Entry
W7S_22780         CDS       T02113                                 

Definition
(GenBank) delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
mmm  Mycobacterium sp. MOTT36Y
Pathway
mmm00860  Porphyrin and chlorophyll metabolism
mmm01100  Metabolic pathways
mmm01110  Biosynthesis of secondary metabolites
mmm01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mmm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    W7S_22780
Enzymes [BR:mmm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     W7S_22780
Exosome [BR:mmm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   W7S_22780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD OMPdecase
Motif
Other DBs
NCBI-ProteinID: AFJ37505
UniProt: I2AJN1
Position
complement(4966705..4967685)
Genome map
AA seq 326 aa AA seqDB search
MSYPRQRPRRLRSTPALRRLVAQTSLEPRHLVLPMFVADGIDEPRPIASMPGVVQHTRDS
LRGAAASAVAAGVGGLMLFGVPRDEDKDAVGSAGTDPDGILNVALRDLAKDLGEATVLMA
DTCLDEFTDHGHCGVLDDRGRVDNDATVARYVKLAVAQAESGAHVVGPSGMMDGQVGAIR
DGLDAAGHTDVAILAYAAKFASAFYSPFREAVSSSLSGDRRTYQQEAGNSREALREIQLD
LDEGADIVMVKPAMGYLDVVSAAASISPVPVAAYQVSGEYAMICAAAANNWIDERAAALE
SLTSIRRAGADIVLTYWAADAAGWLS
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
gtgtcctacccgcggcagcgtccgcgtcggctccgctcaaccccggcgttgcgccgattg
gtcgcgcaaacgtcgctggagccaaggcatttggtgctgccgatgttcgtcgccgacggc
atcgacgaaccccggccgatcgcctcgatgccgggggtggtccaacacacccgcgattcg
ttgcgcggcgccgccgccagcgccgtcgccgccggggtgggcgggctgatgctgttcggt
gtgccgcgtgatgaggacaaggacgcggtggggtcggccggcaccgatcccgacggcatc
ctcaacgtcgccctgcgcgacctggccaaggacctcggcgaggccaccgtgctgatggcc
gacacctgcctggacgagttcaccgatcacggccactgcggcgtcctcgacgaccgcggt
cgggtcgacaacgacgcgaccgtggcccgatatgtgaaactcgctgtggcgcaagcggaa
tcgggcgcgcacgtggtaggtccgagcgggatgatggacggtcaggtgggcgcgattcgc
gacgggctggacgcggccggccataccgacgtggcgatcctcgcctacgccgccaagttc
gcatcggcgttctacagcccgttccgcgaagcggtcagttccagcctctccggcgaccgg
cgcacctatcagcaggaggcgggcaattcccgcgaggcgctccgcgagatccagctcgat
ctggacgagggcgccgacatcgtgatggtgaagccggcgatgggttatctggacgttgtg
tcggcggcggcctcgatttcgccggtgccggtggccgcctatcaggtgtcgggggagtac
gcgatgatttgcgctgcggccgcgaacaattggatcgacgagcgcgcggcggcgctggaa
tcattgacgagcatccggcgcgccggagccgatatcgttctcacctattgggccgcggat
gcggcagggtggctttcgtga

DBGET integrated database retrieval system