KEGG   Mycobacterium sp. MOTT36Y: W7S_22780Help
Entry
W7S_22780         CDS       T02113                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
mmm  Mycobacterium sp. MOTT36Y
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:mmm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    W7S_22780
Enzymes [BR:mmm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     W7S_22780
Exosome [BR:mmm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   W7S_22780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4966705..4967685)
Genome map
AA seq 326 aa AA seqDB search
MSYPRQRPRRLRSTPALRRLVAQTSLEPRHLVLPMFVADGIDEPRPIASMPGVVQHTRDS
LRGAAASAVAAGVGGLMLFGVPRDEDKDAVGSAGTDPDGILNVALRDLAKDLGEATVLMA
DTCLDEFTDHGHCGVLDDRGRVDNDATVARYVKLAVAQAESGAHVVGPSGMMDGQVGAIR
DGLDAAGHTDVAILAYAAKFASAFYSPFREAVSSSLSGDRRTYQQEAGNSREALREIQLD
LDEGADIVMVKPAMGYLDVVSAAASISPVPVAAYQVSGEYAMICAAAANNWIDERAAALE
SLTSIRRAGADIVLTYWAADAAGWLS
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
gtgtcctacccgcggcagcgtccgcgtcggctccgctcaaccccggcgttgcgccgattg
gtcgcgcaaacgtcgctggagccaaggcatttggtgctgccgatgttcgtcgccgacggc
atcgacgaaccccggccgatcgcctcgatgccgggggtggtccaacacacccgcgattcg
ttgcgcggcgccgccgccagcgccgtcgccgccggggtgggcgggctgatgctgttcggt
gtgccgcgtgatgaggacaaggacgcggtggggtcggccggcaccgatcccgacggcatc
ctcaacgtcgccctgcgcgacctggccaaggacctcggcgaggccaccgtgctgatggcc
gacacctgcctggacgagttcaccgatcacggccactgcggcgtcctcgacgaccgcggt
cgggtcgacaacgacgcgaccgtggcccgatatgtgaaactcgctgtggcgcaagcggaa
tcgggcgcgcacgtggtaggtccgagcgggatgatggacggtcaggtgggcgcgattcgc
gacgggctggacgcggccggccataccgacgtggcgatcctcgcctacgccgccaagttc
gcatcggcgttctacagcccgttccgcgaagcggtcagttccagcctctccggcgaccgg
cgcacctatcagcaggaggcgggcaattcccgcgaggcgctccgcgagatccagctcgat
ctggacgagggcgccgacatcgtgatggtgaagccggcgatgggttatctggacgttgtg
tcggcggcggcctcgatttcgccggtgccggtggccgcctatcaggtgtcgggggagtac
gcgatgatttgcgctgcggccgcgaacaattggatcgacgagcgcgcggcggcgctggaa
tcattgacgagcatccggcgcgccggagccgatatcgttctcacctattgggccgcggat
gcggcagggtggctttcgtga

DBGET integrated database retrieval system