KEGG   Mycobacterium sp. MOTT36Y: W7S_22895Help
Entry
W7S_22895         CDS       T02113                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglyceromutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mmm  Mycobacterium sp. MOTT36Y
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mmm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    W7S_22895 (gpmA)
   01230 Biosynthesis of amino acids
    W7S_22895 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    W7S_22895 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    W7S_22895 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    W7S_22895 (gpmA)
Enzymes [BR:mmm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     W7S_22895 (gpmA)
Exosome [BR:mmm04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   W7S_22895 (gpmA)
  Exosomal proteins of melanoma cells
   W7S_22895 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4989756..4990505)
Genome map
AA seq 249 aa AA seqDB search
MGDSATLVLLRHGESEWNSLNLFTGWVDVGLTDKGRTEAVRSGELLAEHNLLPDVLYTSL
LRRAISTAHLALDAADRLWIPVRRTWRLNERHYGALQGLDKAETKARYGDDQFMAWRRSY
DTPPPPIEMGSTYSQDTDPRYADIGGGPLTECLADVVVRFLPYFTDVIIPDLRSGKTVLI
VAHGNSLRALVKHLDRMSDDDIVGLNIPTGIPLRYDLDADLRPVVPGGTYLDPEAAAAGA
AAVAGQGRR
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgggtgactccgccacgctggtcctgctccgtcacggtgaaagcgaatggaattcgctg
aacctgttcaccggttgggtggacgtcgggctgaccgacaagggccgcaccgaggcggtg
cgcagcggcgagctgctggccgaacacaatctgttgcccgacgtcctctacacgtcgctg
ctgcgccgggccatctccaccgcgcacctggcactggacgccgccgaccggctgtggatc
ccggtgcggcgcacctggcggctcaacgaacgccattacggggcgctgcagggcctggac
aaggccgagaccaaggcgcgctacggcgacgaccagttcatggcctggcgacgcagctac
gacacgccgcccccgccgatcgagatgggcagcacctacagccaggacaccgatccccgc
tacgccgacatcggcggcgggccgctgaccgagtgccttgccgacgtggtcgtccgcttc
ctgccgtatttcaccgacgtcatcatcccggacctgcgcagcggcaagacggtgctgatc
gtcgcgcacggcaactcgctgcgggccctggtcaagcacctcgatcggatgtccgacgac
gacatcgtgggcctgaacatcccgaccggcatcccgctgcgctacgacctggacgccgac
ctgcgcccggtggtgcccggcggcacctatctggaccccgaggcggccgccgccggtgcc
gccgcggtcgccggccagggccgccgctga

DBGET integrated database retrieval system