KEGG   Mycobacterium sp. MOTT36Y: W7S_23055Help
Entry
W7S_23055         CDS       T02113                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mmm  Mycobacterium sp. MOTT36Y
Pathway
mmm00071  Fatty acid degradation
mmm00280  Valine, leucine and isoleucine degradation
mmm00281  Geraniol degradation
mmm00310  Lysine degradation
mmm00360  Phenylalanine metabolism
mmm00362  Benzoate degradation
mmm00380  Tryptophan metabolism
mmm00410  beta-Alanine metabolism
mmm00627  Aminobenzoate degradation
mmm00640  Propanoate metabolism
mmm00650  Butanoate metabolism
mmm00903  Limonene and pinene degradation
mmm00930  Caprolactam degradation
mmm01100  Metabolic pathways
mmm01110  Biosynthesis of secondary metabolites
mmm01120  Microbial metabolism in diverse environments
mmm01130  Biosynthesis of antibiotics
mmm01212  Fatty acid metabolism
Module
mmm_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mmm00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    W7S_23055
   00650 Butanoate metabolism
    W7S_23055
  Lipid metabolism
   00071 Fatty acid degradation
    W7S_23055
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    W7S_23055
   00310 Lysine degradation
    W7S_23055
   00360 Phenylalanine metabolism
    W7S_23055
   00380 Tryptophan metabolism
    W7S_23055
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    W7S_23055
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    W7S_23055
   00281 Geraniol degradation
    W7S_23055
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    W7S_23055
   00627 Aminobenzoate degradation
    W7S_23055
   00930 Caprolactam degradation
    W7S_23055
Enzymes [BR:mmm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     W7S_23055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AFJ37560
UniProt: I2AJT6
Position
5019757..5020668
Genome map
AA seq 303 aa AA seqDB search
MPSSDFQTLLYRTAGPVATITLNRPEQLNTIVPPMPDEIEAAVGLAERDPAVKVIVLRGA
GRAFSGGYDFGGGFQHWGESMMSDGKWDPGKDFAMVSARETGPTQKFMAIWRASKPVIAQ
VHGWCVGGASDYALCADLVIASEDAVIGTPYSRMWGAYLTGMWLYRLSLAKVKWHSLTGR
PLTGVQAAEIELINEAVPFERLEARVAEIAAELAQIPLSQLQAQKLIVNQAYENMGLAST
QTLGGILDGLMRNTPDALGFIKIAEDEGVRAAVERRDGPFGDYSQAPPELRPDPSHVIVP
DRD
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgccaagcagcgacttccagaccctgctctaccgcacggccggcccggtggccaccatc
acgctgaaccggcccgagcagctgaacacgatcgtgccgcccatgcccgacgagatcgag
gccgcggtcggcctggccgagcgcgacccggccgtcaaggtcatcgtgctgcgcggggcg
ggccgggcgttctccggcggctacgacttcggcggcggtttccagcactggggcgaatcc
atgatgagcgacggaaagtgggatcccggcaaggacttcgcgatggtcagcgcccgcgag
accgggccgacgcaaaagttcatggccatctggcgggcgtccaaaccggtgatcgcccag
gtgcacggctggtgcgtgggcggtgccagcgactacgcgctgtgcgccgatctcgtcatc
gccagcgaggacgccgtgatcggcaccccctacagcaggatgtggggcgcgtacctgacc
gggatgtggctctaccggctgagcctggccaaggtgaagtggcactcgctgaccgggcgt
cccctgaccggcgtgcaggccgcggagatcgagctgatcaacgaggcggtgcccttcgag
cgcctcgaagcgcgggtggccgagatcgcggccgaactggcgcagatccccttgtcgcag
ttgcaggcgcaaaagctgatcgttaaccaggcctacgagaacatgggcctggcctccacc
cagacgctgggcggcatcctcgacggcctgatgcgcaatacgcccgacgccctgggcttc
atcaagatcgcggaggacgagggcgtgcgcgccgccgtcgagcgccgcgacggcccgttc
ggggactacagccaggccccgccggagctgcggccggacccgtcacacgtcatcgtccct
gatcgggactga

DBGET integrated database retrieval system