KEGG   Mycobacterium sp. MOTT36Y: W7S_24100Help
Entry
W7S_24100         CDS       T02113                                 

Definition
(GenBank) bifunctional uroporphyrinogen-III synthetase/response regulator domain protein
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mmm  Mycobacterium sp. MOTT36Y
Pathway
mmm00860  Porphyrin and chlorophyll metabolism
mmm01100  Metabolic pathways
mmm01110  Biosynthesis of secondary metabolites
mmm01120  Microbial metabolism in diverse environments
Module
mmm_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:mmm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    W7S_24100
Enzymes [BR:mmm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     W7S_24100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 Trans_reg_C Peripla_BP_6 TMEM213
Motif
Other DBs
NCBI-ProteinID: AFJ37769
UniProt: I2AKE5
Position
5237229..5238392
Genome map
AA seq 387 aa AA seqDB search
MAPQLAPPDSAPLTGYRIAVTSANRAEELCALLRRNGAEVSSAAAINLIALPEDEELHRH
TEAVIAEPPDILVAHTGIGFRGWVAAADGWGLATQLLASLSRARIVARGPKATGALRAAG
LHEEWSPRSESSSEVLRYLLESDIAGKRVAVQLHGAADTWDPFPEFLNGLRSAGAQVVPI
HVYRWKPTPAGGDFDQLVTSVARRQFDAVTFTSAPAGAALLERSRELGVEEQLLQALRSD
VHAMCVGPVTAQPLLRAGVPTSSPERMRLGALARHIAQELPTLRSTTIRAAGHEMEIRGT
CVLVDGSPRSLSGSGMATLRALAERPGDVVARNDLLRVLPGNSNDPHAVDTAVLRLRTAL
GDKNIIATVVKRGYRLAIDHPDESPWH
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggccccccaactggccccaccagactccgcgccgctgaccggctaccggatcgccgtg
acgtcggcgaaccgggccgaagagctgtgcgcgttgctgcgccgcaacggcgcggaggtg
tccagcgccgcggccatcaacctcatcgcgctgcccgaagacgaagaactgcaccgccac
accgaagcggtcatcgccgagcctcccgatatcttggtggcgcacaccggcatcggcttc
cgcggctgggtcgccgcggccgacggctggggactggccacccagttgctggcgtccctg
tctcgggcgcggatcgtggcccgcgggccgaaggcgaccggcgccttgcgcgccgccgga
ctgcatgaggagtggtcgcccaggtccgaatcgtcgagcgaggtcctgcgctacctgctc
gaatcggatatcgccggaaagcgggtcgcggtccagctgcacggcgcggccgacacctgg
gacccgttcccggaattcctcaacgggttgcggtccgcgggcgcccaggtggtccccatc
cacgtatatcgctggaaaccaacgccggccggcggcgacttcgaccaactcgtcacctcg
gtcgcccggcggcagttcgacgcggtgaccttcacctcggcgcccgcgggcgcggcgctg
ctggagcgcagccgcgagttgggcgtcgaagaacaactgctgcaagcacttcgcagcgac
gtgcacgcgatgtgcgtgggcccggtcaccgcgcagcccctgctccgcgccggggtcccc
acgtcgtcgcccgagcgaatgcggttgggggcgttggcccgtcacatcgcccaggagctc
ccgacccttcgctcgaccaccatccgggcggccggccacgagatggagatccgcgggacc
tgcgtgctggtcgacggttcgccgcggtccctgtcgggatcgggaatggcgacgctgcgc
gcgctggcggagcgccccggcgacgtcgtcgcgcgcaacgacctgttgcgggtgcttccc
ggcaacagcaacgatccccacgccgtcgacacggccgtgctgcggctgcgaacggcgctg
ggcgacaagaacatcatcgcgacggtggtcaagcgtggctaccggctcgcgatcgaccat
ccggacgaatccccatggcactga

DBGET integrated database retrieval system