KEGG   Candidatus Midichloria mitochondrii: midi_00068Help
Entry
midi_00068        CDS       T01561                                 

Gene name
ruvA
Definition
holliday junction DNA helicase
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mmn  Candidatus Midichloria mitochondrii
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mmn00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    midi_00068 (ruvA)
Enzymes [BR:mmn01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     midi_00068 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(46206..46811)
Genome map
AA seq 201 aa AA seqDB search
MIGKLTGEICLIESEQIIIDVAGVGYVLNIPSSALAAVQIGQTKSFWVFTQVKEGEITLF
GFTSKEEKQLFEALITVQGVGGKVALAILSSMTPTMVTAAIIAQDITAFKRVSGIGPKLA
ARIVNELKDKKALVTGAYSFIDAATPLEGSQSMALDAASVLANLGFVRSEAFKTAAEILK
NDEQISLEELIKKSLSQITNI
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgataggaaaattaaccggagaaatttgcttaatagagtcagagcaaattattattgat
gtagcaggagtcggatacgtacttaatatcccctcttcagctctagccgccgtacaaatt
gggcaaacgaagtctttttgggtgtttactcaagtaaaagaaggagaaataactctcttt
ggatttacttcaaaagaagaaaaacaattatttgaagcacttattacagtccaaggcgtg
ggcggcaaagtagctttagccattttgagttcaatgacccctactatggtcactgctgca
attatagcgcaagatataactgcttttaaaagagttagcggtattgggcctaagcttgct
gctaggatagttaatgaattaaaagataaaaaagctttagtaacaggcgcatattcattc
atcgatgctgctacccctcttgaaggtagtcaaagtatggctttggatgctgcttcagta
cttgctaatttaggctttgttaggtctgaagcctttaaaactgcagctgagattttaaaa
aatgatgaacaaatcagtttggaagaattaatcaaaaaatcattgagccagattacaaat
atatga

DBGET integrated database retrieval system