KEGG   Candidatus Midichloria mitochondrii: midi_00106Help
Entry
midi_00106        CDS       T01561                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
mmn  Candidatus Midichloria mitochondrii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mmn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    midi_00106
Enzymes [BR:mmn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     midi_00106
Exosome [BR:mmn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   midi_00106
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
79467..80393
Genome map
AA seq 308 aa AA seqDB search
MFAENHIHRSQLILPIFVKEGEQIAIPSMPDVNVLSMGLCIDTVKRAYNEGISAVALFPR
INKSLKDEFGGYAIKPNNLLCKTISAIKKVVPDIGIIADIALDPYTIHGHDGVLDIEGLV
DNDKTVEILTKQALILADSGCDILAPSDMMDGRIRSIRSALEENKFLNTQIFSYAAKYAS
KLYGPFREAVDSSISLGSTDKKHYQLNPANINEAMRKVKLDIAEGADAIIVKPSLFYLDV
VREIKNSYPTPVITYQVSGEYTALKIAAIQGIYSYEDVQIEFLLSCKRAGASCVITYGAL
EIAKLLPK
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgtttgctgaaaaccatattcatagatctcaactgatcttgcctatatttgtgaaagaa
ggggagcaaattgcaatcccgtctatgccggatgtaaatgtacttagtatgggcctctgt
atagatacagtaaaaagagcttataatgaggggatttcagcggttgctttattccctaga
attaacaaatctctaaaagacgagtttggtggctatgctataaaacctaataatctactt
tgcaaaaccatttctgctataaagaaagttgtgccagatatcggtataatagctgacatt
gcactcgacccttatacaatacatggacatgatggagttttagatatagaagggttagtt
gataacgataaaactgttgaaatactaacaaagcaagctttaatcctagcagattctgga
tgcgatattctagctccttccgatatgatggatggcagaatacgctctattcggtctgcc
cttgaagagaataaatttttaaatacgcaaatattttcttatgccgctaaatatgcttca
aaactttatggaccatttcgtgaagcagttgattcaagtatatccttaggatcaactgat
aaaaaacactatcagctaaatcctgctaatattaatgaagcgatgcgaaaagttaaactg
gatatagcagaaggagcggatgctattatagtgaaaccttcacttttttatttagatgtt
gttagagagataaagaactcgtatccaactccggtaatcacttaccaagtaagcggggag
tatactgcgcttaaaattgcagctatacaagggatttattcttatgaagatgttcaaatt
gagtttttactttcctgtaaaagggcaggggcctcgtgtgttataacctatggtgcactt
gaaatagctaagctattaccaaaataa

DBGET integrated database retrieval system