KEGG   Candidatus Midichloria mitochondrii: midi_00135Help
Entry
midi_00135        CDS       T01561                                 

Gene name
recR
Definition
recombinational DNA repair protein
Orthology
K06187  
recombination protein RecR
Organism
mmn  Candidatus Midichloria mitochondrii
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mmn00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    midi_00135 (recR)
DNA repair and recombination proteins [BR:mmn03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      midi_00135 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
105058..105645
Genome map
AA seq 195 aa AA seqDB search
MQQNSLRNLISIIAKLPGLGRRSARRIALHLLQHKELMHKLSESIISTAKEMKFCEICNN
LDSVSPCAICSSSTRDKSLICVVEGVADLWALERSRLYNGLYHVLGGTLSAINGTTPESL
TIDKLKRRLVSNIGEVIIATNATLEGESTGHYIASLVEKAGIKATRLAHGIPMGAELDHM
DDGTLTIALKLRQLF
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaaaattctttacgaaatttaatatcaataatagctaaactccctggattaggg
cgtagatcggctcgccgtattgcgctccatttactgcagcataaagaattaatgcataaa
ttatcagagtccataattagtactgctaaagagatgaagttctgtgaaatatgtaataat
ttagattctgtttctccatgcgcaatttgtagttctagtactagagataagagcttgata
tgtgttgttgaaggagtagctgacttgtgggctctggaacgcagcaggctctataatggt
ttataccatgttttgggcggtacattatctgcaataaatggtacaaccccagaatcgcta
actatagataaattaaaaagaaggttagtcagtaatatcggtgaagttattatagcgaca
aatgcaactttggaaggagagagcactggacattatattgcgagcttggtcgaaaaagct
ggtattaaggcaactagattagcgcatggaatacctatgggagcggagttggatcatatg
gatgatggaaccttgactattgcattgaaattaaggcaattgttttaa

DBGET integrated database retrieval system