KEGG   Candidatus Midichloria mitochondrii: midi_00192Help
Entry
midi_00192        CDS       T01561                                 

Gene name
gmk
Definition
guanylate kinase Gmk (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
mmn  Candidatus Midichloria mitochondrii
Pathway
Purine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:mmn00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(160117..160764)
Genome map
AA seq 215 aa AA seqDB search
MHGSSDNIKRRGLMLVISAPSGAGKTTLSKLLIENDQHLRASISVTTRKKRPGEVDGKDY
HFVDTAKFKQMVKDNAFMEYAEIFGNFYGTPKDAVEKFLEVGEDVVFDIDWQGHRRLVAT
TREDVTSVFILPPSKQELYKRLKLRHHDEEGVAAFRQERANDEISHWHEYDYVIINKGLN
ESFNKLLSILRAERLKKNRRTGLPAFIRDLLKQEV
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgcacggatcatcagataatataaaacgcagaggattaatgttggttatttcagccccc
tctggtgcaggaaaaacaactttgtcaaaattactaattgaaaacgatcagcatttaaga
gcttcgatttctgttaccactagaaagaaacgtcctggtgaagttgatggcaaagattat
cattttgtagatacagctaaatttaaacagatggtcaaggataacgcattcatggaatac
gctgaaatttttggtaatttttatggtactcccaaggatgcagtagaaaaatttttagag
gtgggagaagatgtagtctttgatatagattggcaaggacataggcgccttgttgcaact
acaagggaagatgttactagtgtgtttatactccctccttctaaacaagaactttacaaa
cgacttaagttacgccatcatgatgaagaaggagtggcagccttcaggcaagaaagggcc
aacgatgaaataagtcactggcatgaatatgattatgttataattaataagggtctaaat
gaaagttttaataaattgctttcgatattaagagcagaacgcttgaaaaaaaatagaaga
accggcttacctgcttttataagagacttgctaaaacaagaagtgtaa

DBGET integrated database retrieval system