KEGG   Candidatus Midichloria mitochondrii: midi_00286Help
Entry
midi_00286        CDS       T01561                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mmn  Candidatus Midichloria mitochondrii
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mmn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    midi_00286 (tpiA)
   01230 Biosynthesis of amino acids
    midi_00286 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    midi_00286 (tpiA)
   00051 Fructose and mannose metabolism
    midi_00286 (tpiA)
   00562 Inositol phosphate metabolism
    midi_00286 (tpiA)
Enzymes [BR:mmn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     midi_00286 (tpiA)
Exosome [BR:mmn04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   midi_00286 (tpiA)
  Exosomal proteins of bladder cancer cells
   midi_00286 (tpiA)
  Exosomal proteins of melanoma cells
   midi_00286 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(257792..258484)
Genome map
AA seq 230 aa AA seqDB search
MTQKLVVANWKMNILLHEAVALLESVNIGSLHKSLVICPSFIYIPTLVDAFKKLDFGAQD
CSANDLGAYTGEVAAAMLYEIGCKYVIIGHSERRISCGEDNQTVGRKLVKALESKITPVI
CIGESLEVRNQGSTLEHLFKQLEEIGISRNKKFVIAYEPIWAIGSGVTPSVDEVKAIFNK
IKGAYPYLQLLYGGSVGPENADEFFGIDVLDGLLVGGAGLSAQKLNQILS
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgacccaaaagctagtagttgcaaattggaagatgaatatccttttgcacgaagcggtt
gctctgcttgaatccgttaatatagggagtcttcataagagtttagtaatctgtccgtct
tttatttatataccaacattagtggatgcgtttaagaaattagattttggagcgcaggat
tgctctgcgaatgatttaggggcgtatactggtgaggttgcggcggcaatgttatatgag
attggatgtaaatacgttattattggacattccgaaagacgtattagttgcggtgaagat
aatcaaacagtaggtagaaaattagttaaggctttagaatcaaagattactcctgtaatt
tgcataggagagtctctggaggtcagaaatcagggtagtactctggaacatctatttaag
cagcttgaagagataggaataagtagaaataaaaaatttgtaattgcatatgagcccatt
tgggctataggctcgggcgttaccccgagcgtcgacgaggttaaggctatatttaataaa
atcaaaggggcctacccctatcttcaacttctatacggagggtctgtaggtccagagaat
gccgatgaattttttggtatagatgttctagatggtttattagttggaggcgccggcctg
agcgcgcaaaaattgaatcaaatattgagctaa

DBGET integrated database retrieval system