KEGG   Candidatus Midichloria mitochondrii: midi_00385Help
Entry
midi_00385        CDS       T01561                                 

Definition
protein-L-isoaspartate carboxylmethyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
mmn  Candidatus Midichloria mitochondrii
Brite
Enzymes [BR:mmn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     midi_00385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
358245..358892
Genome map
AA seq 215 aa AA seqDB search
MQNLTTEDQNLVKARNNMVQNQIVPNNITDIAVLTALKFVPKHIFVEDRFQPVAYSEGSI
SAGSGRIILEPVIFAKMLQACTIKKTDIVLDIGCGLGYSTAVLALLSRAVVGVENNLHLI
VSAKHNLSILGIDNFAIHSADFSYGHPDKAPYDIIFINGALRKTSEILFEQLSNGGRLVN
IEQTSSGVAMAVLYTKHQDQLYRQDIYHCNLNYIE
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatttaactacagaagatcaaaatttagtgaaggctagaaataatatggtacaa
aatcagatagtaccaaataatatcactgatattgccgtactaactgcgttaaagtttgtt
cctaagcatatatttgtagaagatagattccagccagttgcatatagcgaaggtagtata
agcgccggttccggtagaattattttggaaccagttatttttgcaaaaatgcttcaagcc
tgcactattaaaaaaacagatatagttctagatattggatgcggcctaggatactcaact
gcggttctcgcattgctatctagagctgtagtcggcgttgaaaataatttacatttaata
gtgagtgcaaaacacaatttaagtattttaggtattgataattttgctattcactccgct
gacttcagctatggtcaccctgacaaagctccttatgatattatctttattaacggagca
ctccggaaaacatctgaaatattgtttgaacaattaagcaatggcggaagattagtaaac
attgagcaaacatcttctggtgtggctatggcagttctatatacgaaacatcaagatcaa
ttataccgtcaagacatataccattgtaacctgaactatatagaataa

DBGET integrated database retrieval system