KEGG   Candidatus Midichloria mitochondrii: midi_00402Help
Entry
midi_00402        CDS       T01561                                 

Definition
acyl-CoA desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
mmn  Candidatus Midichloria mitochondrii
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:mmn01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:mmn01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
376457..377650
Genome map
AA seq 397 aa AA seqDB search
MKGDTSLRINWVTTSVLIFYPLLLIIAAIIYCDRYGTGWFEWGMAIAAHYVYNISVGIGL
HRLWAHSAYKTNKFVEFILMIISSGTLQGPAIAWASDHALHHTYMDEELDPHSPLKFKNK
LKGFLWSHIGWMLFEDISKKHIDKGTMRRLGRSRILVFQLRHYWKLALGMNLVVPFIVGY
LIGGDLKSAVAAYIFIGLGRAFQQQMTFCVNSLTHVIGSQPYLNGTPGEIPWMFFLLLGE
NWHNYHHAFARDYRNGWKWHQLDIHKWIIYLMSKVGLAHDLVVTPKERILAKQAEAKLEL
TELMKDKLSSIEIGAIGIADMARQQIRNLEKGANMIADSIKVKLVNLEEAAENLLHSIRG
KMQNCSFKSQEKVVKAALKKLEELEVVAYKLGLSKAS
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaagggcgatacttccttaagaataaattgggtcacaacaagcgtactgattttttat
cctttgcttcttataattgcagcaataatttattgtgatcgatatggcactggttggttc
gagtggggaatggcaatagctgctcactatgtttacaatatatcggtagggatagggtta
catagactctgggcgcatagcgcctataaaacaaataaatttgtagaattcatattaatg
ataatttctagtggtactctgcaaggtcccgctatagcttgggcttccgatcatgcatta
catcacacctatatggatgaggaattagatcctcactctcctttaaaatttaaaaataaa
ctaaaaggctttctttggtcacatatagggtggatgttatttgaggatatttctaaaaag
catatagataagggaacaatgagacgcctaggccgtagtagaattttggtgttccagttg
cggcattattggaagctagctttaggtatgaatttagtagtgccgtttattgtcgggtat
ttaattgggggcgatttaaaatctgctgttgctgcatacatctttatagggctcggccgt
gcctttcagcagcagatgactttttgcgtgaattcgctaactcacgttataggcagccag
ccatatttgaacggcactcctggagaaattccttggatgtttttcttattgcttggggag
aattggcataattaccatcatgcatttgctagagattatagaaatggttggaaatggcat
caattagatatacataagtggattatataccttatgagtaaggtaggtttagcacacgat
ttggttgtcactccaaaagagagaatccttgccaagcaggcagaagcaaaattagagttg
actgaattaatgaaggataagctttcaagcattgaaataggggcaattggtatagctgat
atggcaaggcaacagattaggaatctagagaagggtgcaaatatgattgctgatagcatt
aaggtcaaactagtaaatcttgaagaggccgcggaaaatttattgcatagtataagggga
aagatgcaaaattgttcctttaaatcacaggaaaaagttgtgaaagctgccttaaagaaa
ttggaagaacttgaagtcgtagcctataagttaggtttatctaaagcttcttga

DBGET integrated database retrieval system