KEGG   Candidatus Midichloria mitochondrii: midi_00527Help
Entry
midi_00527        CDS       T01561                                 

Gene name
bglX
Definition
beta-glucosidase (EC:3.2.1.21)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
mmn  Candidatus Midichloria mitochondrii
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mmn00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    midi_00527 (bglX)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    midi_00527 (bglX)
Enzymes [BR:mmn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     midi_00527 (bglX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
498667..499626
Genome map
AA seq 319 aa AA seqDB search
MSLDYQEIRAAIVPVQSFDLTIEESQLFKKYKPLGYILFSRNYQSPAQLRRLTDSLKEAS
GRDGILILIDQEGERVSRLKEPHFKVLPNAIKYNRDAKINLNATQERLRSDFALVGKQLR
EAGVNVNCAPVADIRYDWADPIIGVRSYGNDINTVVALCEAADKGLAESKVQSIIKHIPG
HGRALVDSHLELPVVSTDLKTLLETDFKVFQRSGAMKLAMTAHVVFAAIDDEVPVTLSKK
AIDFIKRDIAFNGLTITDALDMQALRGDIGEVTQKASAAGCDILLYCRADLKGVEVVLQN
SHKLKYHIIERVKSFNCFC
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgtcattagattaccaagagattagagctgcaatagtgccggtccaatcttttgattta
acgattgaagaaagtcaattgtttaaaaaatataagccccttggatatatattgttttct
aggaattatcaaagtcccgcccaactaagacggcttacagactctttaaaagaagcatca
gggcgtgatggtatccttattttaattgatcaagaaggagaaagggtatccaggttaaag
gagcctcattttaaagtgctgccaaatgctataaaatataatcgagatgctaaaatcaat
cttaatgcaactcaagaacgattaaggtctgattttgctttggtcggaaaacaactacga
gaggcaggtgttaatgtgaattgcgcaccagtagcggatattcggtatgactgggcagat
ccaataataggagtaagaagttacggtaacgatattaatacagttgttgcactgtgtgaa
gcagcagataagggcttagctgaatcaaaagtgcaatctataattaaacatatcccaggg
catggtcgcgctttagtagatagccatctggagcttccagttgtatctacggatctaaaa
actttattagaaactgattttaaggtgtttcagcggtcgggtgcaatgaaattagctatg
acagcgcatgtagtttttgcggcaattgatgatgaagtaccagttacactctctaaaaag
gccatagacttcattaaaagagatattgcatttaacggattaactatcacagatgcatta
gatatgcaagcattgagaggcgacataggagaagttacgcaaaaggcttcagccgctggt
tgtgatatcttgctttattgtagagcagatctgaaaggagttgaggtagtgttgcagaac
agccacaaattaaaatatcatattatagagcgggttaaatcctttaattgtttttgctga

DBGET integrated database retrieval system