KEGG   Candidatus Midichloria mitochondrii: midi_00527Help
Entry
midi_00527        CDS       T01561                                 

Gene name
bglX
Definition
beta-glucosidase (EC:3.2.1.21)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
mmn  Candidatus Midichloria mitochondrii
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:mmn00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:mmn00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
498667..499626
Genome map
AA seq 319 aa AA seqDB search
MSLDYQEIRAAIVPVQSFDLTIEESQLFKKYKPLGYILFSRNYQSPAQLRRLTDSLKEAS
GRDGILILIDQEGERVSRLKEPHFKVLPNAIKYNRDAKINLNATQERLRSDFALVGKQLR
EAGVNVNCAPVADIRYDWADPIIGVRSYGNDINTVVALCEAADKGLAESKVQSIIKHIPG
HGRALVDSHLELPVVSTDLKTLLETDFKVFQRSGAMKLAMTAHVVFAAIDDEVPVTLSKK
AIDFIKRDIAFNGLTITDALDMQALRGDIGEVTQKASAAGCDILLYCRADLKGVEVVLQN
SHKLKYHIIERVKSFNCFC
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgtcattagattaccaagagattagagctgcaatagtgccggtccaatcttttgattta
acgattgaagaaagtcaattgtttaaaaaatataagccccttggatatatattgttttct
aggaattatcaaagtcccgcccaactaagacggcttacagactctttaaaagaagcatca
gggcgtgatggtatccttattttaattgatcaagaaggagaaagggtatccaggttaaag
gagcctcattttaaagtgctgccaaatgctataaaatataatcgagatgctaaaatcaat
cttaatgcaactcaagaacgattaaggtctgattttgctttggtcggaaaacaactacga
gaggcaggtgttaatgtgaattgcgcaccagtagcggatattcggtatgactgggcagat
ccaataataggagtaagaagttacggtaacgatattaatacagttgttgcactgtgtgaa
gcagcagataagggcttagctgaatcaaaagtgcaatctataattaaacatatcccaggg
catggtcgcgctttagtagatagccatctggagcttccagttgtatctacggatctaaaa
actttattagaaactgattttaaggtgtttcagcggtcgggtgcaatgaaattagctatg
acagcgcatgtagtttttgcggcaattgatgatgaagtaccagttacactctctaaaaag
gccatagacttcattaaaagagatattgcatttaacggattaactatcacagatgcatta
gatatgcaagcattgagaggcgacataggagaagttacgcaaaaggcttcagccgctggt
tgtgatatcttgctttattgtagagcagatctgaaaggagttgaggtagtgttgcagaac
agccacaaattaaaatatcatattatagagcgggttaaatcctttaattgtttttgctga

DBGET integrated database retrieval system