KEGG   Candidatus Midichloria mitochondrii: midi_00640Help
Entry
midi_00640        CDS       T01561                                 

Gene name
holC
Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
mmn  Candidatus Midichloria mitochondrii
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:mmn00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:mmn00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:mmn03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:mmn03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mmn03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
605740..606054
Genome map
AA seq 104 aa AA seqDB search
MHKLDNDLWTYSVLAFLPHATEEDTFLDQQKILLTTQTSNLNDANVLLANYVVPELVGNY
ERFVSIYDTSTDEGLIQEQVKNLAALNIPVTIFEEERGSWKRVD
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atgcataagctagacaatgatctctggacatattctgtattagcatttctacctcatgct
actgaagaagatacgtttttagatcaacagaagattttgcttactactcaaactagcaat
ttaaatgacgcaaatgtgcttctggcaaattatgtagtacctgaattggtcggtaactat
gagagatttgttagcatatatgatacctctacggatgaagggctcattcaagaacaggta
aaaaacttagcagcccttaatattcccgttacaatttttgaagaagaaaggggctcatgg
aaacgcgttgattaa

DBGET integrated database retrieval system