KEGG   Candidatus Midichloria mitochondrii: midi_00683Help
Entry
midi_00683        CDS       T01561                                 

Definition
putative cytochrome C transmembrane protein
Orthology
K08738  
cytochrome c
Organism
mmn  Candidatus Midichloria mitochondrii
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:mmn00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    midi_00683
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    midi_00683
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
646095..646451
Genome map
AA seq 118 aa AA seqDB search
MRTIMANANAKLGEDVFKKCAVCHTAEKGGANKVGPNLWGIVNAITAHKSDFTYSAAILA
RAQPNLKWDYETLYRYLYAPRKFVPGTKMAFAGIKKDEERANLIAYLRTLSDSPPKLP
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgcgtactattatggccaatgccaatgctaaacttggtgaggatgtctttaaaaaatgt
gctgtgtgtcatactgcagaaaaaggcggagctaacaaagttgggccaaatctttggggt
atagtgaatgctattactgcacataaatcagacttcacatattcagccgctatacttgcc
cgtgcgcaaccaaacctaaaatgggactatgaaacactgtacagatacttgtatgctcct
agaaaatttgtccctggcacaaaaatggcttttgcaggtattaagaaagatgaagaaaga
gcaaatttaatagcatatctaagaacattatctgattctccccctaaattaccataa

DBGET integrated database retrieval system