KEGG   Candidatus Midichloria mitochondrii: midi_00690Help
Entry
midi_00690        CDS       T01561                                 

Gene name
sucB
Definition
dihydrolipoamide acetyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mmn  Candidatus Midichloria mitochondrii
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:mmn01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:mmn00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:mmn00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
653572..654249
Genome map
AA seq 225 aa AA seqDB search
MSRLRKTIAARLKDSQNTAAILTTFNEVNMSAIIQARQTYQEKFQKKHGIKLGFMSFFVK
AVIQALKEIPAVNAEINGDDIIYKNYYDIGVAVGTENGLVVPVVRDADSLSFAEIEKTIA
NLGQKAKESKLSIADMSGGTFSITNGGIYGSMLSTPIINPPQSAILGMHNIVERPYVVKG
QIVVRPIMYIALSYDHRIIDGKEAVTFLFRIKEMIETPERLLFDI
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgagtagactaagaaaaactattgctgcaagattaaaagattctcaaaataccgctgct
attttaactacttttaacgaagttaatatgtcagcgattatacaagcgcgtcaaacttat
caggaaaaattccaaaaaaagcatggcataaaattggggtttatgtccttttttgtaaaa
gctgtaatccaggcattgaaagaaatccctgcggttaatgcagaaattaacggcgatgat
attatatataaaaattactatgatattggagtggccgttggcaccgaaaatggtctagtg
gtacccgttgtgagagatgcggattccttatcctttgccgagatagaaaaaactatcgct
aatttggggcaaaaagctaaagaaagtaaattgagtatagccgatatgagcggcggtaca
tttagtattactaatggtggtatctatggctccatgctttcaacaccaataattaatcca
cctcagtcagcaattcttggtatgcacaatatcgttgaacgtccttatgttgttaaaggt
caaatagttgttcgccctataatgtatattgctctttcatatgatcaccgaatcattgat
ggcaaagaagcagtaacattcttattccgaatcaaagagatgatagaaactcctgagagg
ttattatttgatatttag

DBGET integrated database retrieval system