KEGG   Candidatus Midichloria mitochondrii: midi_00749Help
Entry
midi_00749        CDS       T01561                                 

Gene name
galU
Definition
(GenBank) UTP glucose 1 phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mmn  Candidatus Midichloria mitochondrii
Pathway
mmn00040  Pentose and glucuronate interconversions
mmn00500  Starch and sucrose metabolism
mmn00520  Amino sugar and nucleotide sugar metabolism
mmn01100  Metabolic pathways
mmn01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mmn00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    midi_00749 (galU)
   00052 Galactose metabolism
    midi_00749 (galU)
   00500 Starch and sucrose metabolism
    midi_00749 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    midi_00749 (galU)
Enzymes [BR:mmn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     midi_00749 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AEI89039
UniProt: F7XWJ0
Position
713949..714818
Genome map
AA seq 289 aa AA seqDB search
MYKKIRKAVFPVGGLGTRFLPATKSMPKEMLPVLNKPLIHHAFEEARNAGIEQFIFITGR
NKNSINDHFDHAIELENFLEFKNNKDMLFLSKDCLIEPGNIVFLRQQQPLGLGHAVWCAR
NIIGDEPFAVILADDMFIEDRKCGILTEMIQYFQSDTTANIIGISKINISESKKYGIVKI
GDGDIVEDMIEKPEVSDAPSGLAIVGRYILQPDIFYYLKGTEADKGGEIQLTNAMKKMLA
NSKFRAYRTNAYRLDCGNYLGYLEANVRFSLQNSEFSEPIKEMLKNILG
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgtataagaaaatcaggaaagcagtattcccagttggtggcctcggtactcggttttta
cctgcaaccaagtcgatgcccaaagaaatgcttcctgtgctaaacaagcctttaatacat
cacgcttttgaagaggctagaaatgctggtattgagcaatttatttttattacagggaga
aataagaattctatcaatgatcattttgaccatgctattgaattagagaatttcctagaa
tttaagaataacaaagatatgttatttctatctaaagattgtttgattgaacctggtaat
atagtcttcttgagacaacagcagcccttagggcttggccatgccgtttggtgcgcaaga
aatattataggtgacgaaccttttgcggtaatattagcagatgatatgttcatagaagat
cgaaaatgcggcatcttaacagagatgattcaatattttcaatctgataccactgctaat
attattggtatttctaaaattaatataagcgaaagtaaaaaatatgggatagttaaaatt
ggggatggagatattgttgaagatatgatagaaaagccagaagtaagtgacgctccttct
ggtttagctatagtcggaaggtacatattacaaccagatattttttattatctgaaaggt
actgaagcggataaaggtggggaaatacagttaactaatgcaatgaaaaaaatgttggct
aatagcaagtttagagcgtatagaaccaatgcttatagactagactgcggaaattatttg
ggatatttagaagccaatgtaagattttctctgcaaaatagcgaattttctgagcccata
aaagaaatgttaaaaaatatattagggtaa

DBGET integrated database retrieval system