KEGG   Candidatus Midichloria mitochondrii: midi_00753Help
Entry
midi_00753        CDS       T01561                                 

Gene name
dxr
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
mmn  Candidatus Midichloria mitochondrii
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:mmn00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
718448..719608
Genome map
AA seq 386 aa AA seqDB search
MQKEVLILGSTGSIGESTLRVIDQHSDKFKVKTLIAKSSIDKLVKQARHYLPQNVAISDK
TGYKSLKKMLSNLPRINVISGEEAINDLLKEQYDVTIAAIVGMECLQPIIKVIPNTKILG
LANKESIVCAGSLLMDFARKHNTKIIPVDSEHNAIFQVFEKKNAIKINRVILTASGGPFL
NRSIEEMRTAKPSDAVAHPVWSMGAKISVDSATLMNKGLELIEARYLFDIEPSRLEAVIH
PQGLVHGLIEYADGSMLAQMSLPDMCTPISSALNYPERLDIKHRKITWEKLSSVQFFTPD
ETKFKCLKLAKDTLKSGQGRCIQLNMANEIAVNAFLNSGLPFLKIPEIIEEVLNSISNLS
IKTIEDVFAAAQGAGAKAAEVLLTKL
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaagaagttctaatacttggctcaactggatccataggagaaagcacgttacgc
gttatagatcaacactctgataaatttaaagttaaaactctaattgctaaatctagtata
gataaattagtaaagcaagctaggcattacttgccgcaaaatgtagcgatcagcgataaa
actggttacaaatctttgaaaaaaatgttatctaaccttccaagaatcaatgttataagc
ggagaagaagctattaatgatcttctaaaagagcaatatgacgttactatagctgcaatt
gttggtatggaatgccttcagccaataataaaagttataccgaacactaaaatacttggc
cttgccaataaagaaagtatcgtgtgtgcaggcagccttttaatggattttgctagaaag
cacaatactaagattataccagtagattctgaacataatgcaatatttcaagtttttgaa
aaaaaaaatgccataaaaattaatagagttatattaactgcttctggtgggccattttta
aatagatcgattgaagaaatgagaacagctaaaccgagtgatgcggtcgctcacccggtc
tggagcatgggagccaaaatttctgttgattctgcaactcttatgaacaagggattggaa
ttaattgaagcccgttacctttttgatattgaacccagcagattagaggcagtaattcac
cctcagggcttagtacacggcttaattgaatacgcagatggttcgatgttggctcaaatg
tcgttgccggatatgtgtactcctatttcttcagctttaaattatccagaaaggcttgat
attaagcaccgaaaaataacttgggaaaagttatcatcagtacaattttttactccagat
gaaacaaaattcaagtgtttaaaactagctaaggacacactaaaaagcgggcagggcagg
tgtattcaattgaatatggcgaatgaaattgctgttaacgcttttttaaacagcggctta
ccatttctaaaaattccagaaataatagaagaagtcttaaatagcatctctaatctctca
ataaaaactattgaagacgtttttgccgcagcgcaaggggcgggcgctaaagctgctgag
gttttgctaacaaaattatag

DBGET integrated database retrieval system