KEGG   Candidatus Midichloria mitochondrii: midi_00962Help
Entry
midi_00962        CDS       T01561                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
mmn  Candidatus Midichloria mitochondrii
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mmn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    midi_00962 (dapE)
  Amino acid metabolism
   00300 Lysine biosynthesis
    midi_00962 (dapE)
Enzymes [BR:mmn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     midi_00962 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
903914..905059
Genome map
AA seq 381 aa AA seqDB search
MRQIGLLQQLIRFKSVAPTDNGCLKFLDQLLQNIGFECHLIEFQEEGLEPVQNLYARLGK
KGKNFCFAGHVDVVPPGKEAEWYVPPFSGDEVDGHIYGRGAVDMKGALAAFIETIRRGVD
KNIVNQENSISLLLTADEEGIAINGTKKMVPWLEARNEKIDLCIIGEPTSTKSIGDTIKI
GARGSITLSIEVVGKQGHVAYHQLAENPIPILANIIKELKSISLDNGNLHFQPSNLEFTD
LSVENEAENVIPSAAKARCNIRFGNMHTSKSLAAWVEKICEKYTNNFHLKWHSSGEAFVT
NYERLAPIVAEAIKEVANIDSQINTLGGTSDARFLTRYCPTVEIGLLNKTAHQINEHVSS
EDLELLTGIYMKILQKCEIFK
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgagacaaataggtctattgcaacagcttattcgctttaaaagtgttgctcctacagat
aatggttgcttaaaatttttggatcaattgttgcaaaatatcggatttgagtgccatctt
attgaatttcaagaagagggattagaacctgttcaaaatctttatgcgaggctaggtaaa
aaaggcaaaaatttttgttttgcagggcatgttgacgtggtgccgcctggaaaggaagca
gagtggtatgttccaccttttagtggtgatgaagtagatggacatatttacggtagagga
gcagttgatatgaagggagcgcttgcagcctttattgaaacaataaggaggggagtagat
aagaatattgttaatcaagagaatagtatcagccttttactgactgctgacgaggaggga
atagcaatcaatggtaccaaaaaaatggtgccttggcttgaagcaagaaacgaaaaaatc
gatctctgtattataggtgaacctacaagcacaaaatctattggagatacaattaagatt
ggggcacgaggtagtattactcttagcattgaagtggtaggtaaacaaggacatgtagct
tatcaccaacttgctgagaatcctattcctattcttgcaaatatcattaaggaacttaaa
tcaatcagcctagataatggaaatttgcatttccagccttctaatttagagtttactgat
ttaagtgtggaaaatgaagcagagaacgttataccgtcggctgcaaaggctagatgtaat
attaggtttggcaatatgcacacctcaaaaagtcttgctgcctgggttgagaagatatgt
gagaagtacacgaataactttcatttaaaatggcacagcagcggtgaagcttttgtaacc
aactacgaaagacttgcgccaatagttgcggaagcaattaaagaagttgctaatattgac
tcacaaatcaataccttaggtggtacctctgatgcacggtttttaactagatattgtcca
acagttgaaattggtttacttaacaaaaccgcccatcagatcaacgagcatgtttcttca
gaggacttagagctgcttacaggtatctacatgaaaatcctacaaaaatgtgaaattttt
aaataa

DBGET integrated database retrieval system