KEGG   Candidatus Midichloria mitochondrii: midi_00995Help
Entry
midi_00995        CDS       T01561                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase membrane anchor subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
mmn  Candidatus Midichloria mitochondrii
Pathway
mmn00020  Citrate cycle (TCA cycle)
mmn00190  Oxidative phosphorylation
mmn00650  Butanoate metabolism
mmn01100  Metabolic pathways
mmn01110  Biosynthesis of secondary metabolites
mmn01120  Microbial metabolism in diverse environments
mmn01130  Biosynthesis of antibiotics
mmn01200  Carbon metabolism
Module
mmn_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mmn_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mmn_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mmn00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    midi_00995 (sdhD)
   00650 Butanoate metabolism
    midi_00995 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    midi_00995 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS DUF1776 DUF759
Motif
Other DBs
NCBI-ProteinID: AEI89275
UniProt: F7XTR6
Position
complement(933064..933435)
Genome map
AA seq 123 aa AA seqDB search
MSNLSSKSAVNHYITQRLTAIVLIPIAVWFIVVVFKISKADSLAELGERLLSPFNMITAI
LFVIAALYHGLLGIKEIVTDYVHCSTLKKVLVSSLVLVTIISAIAGIFSLVYFFIMLKIF
FPC
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgtctaatttatcttcaaaatcagcagtaaatcattatataactcaacgtttaactgca
attgtgttgatacctattgctgtgtggtttattgtagtggtatttaagatttctaaagca
gactctttagcagagcttggcgagcggttgttatctccttttaatatgataactgcaatt
ttatttgtaattgctgctctttaccatggccttttaggcattaaagaaatagttacggat
tatgtccattgttcgacattaaagaaggtgttggtttcatcattagtcttagtaacgatt
atctctgcaattgcggggattttctcgcttgtttatttttttatcatgttaaaaatattc
tttccttgttaa

DBGET integrated database retrieval system