KEGG   Candidatus Midichloria mitochondrii: midi_00995Help
Entry
midi_00995        CDS       T01561                                 

Gene name
sdhD
Definition
succinate dehydrogenase membrane anchor subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
mmn  Candidatus Midichloria mitochondrii
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mmn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    midi_00995 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    midi_00995 (sdhD)
   00650 Butanoate metabolism
    midi_00995 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    midi_00995 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(933064..933435)
Genome map
AA seq 123 aa AA seqDB search
MSNLSSKSAVNHYITQRLTAIVLIPIAVWFIVVVFKISKADSLAELGERLLSPFNMITAI
LFVIAALYHGLLGIKEIVTDYVHCSTLKKVLVSSLVLVTIISAIAGIFSLVYFFIMLKIF
FPC
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgtctaatttatcttcaaaatcagcagtaaatcattatataactcaacgtttaactgca
attgtgttgatacctattgctgtgtggtttattgtagtggtatttaagatttctaaagca
gactctttagcagagcttggcgagcggttgttatctccttttaatatgataactgcaatt
ttatttgtaattgctgctctttaccatggccttttaggcattaaagaaatagttacggat
tatgtccattgttcgacattaaagaaggtgttggtttcatcattagtcttagtaacgatt
atctctgcaattgcggggattttctcgcttgtttatttttttatcatgttaaaaatattc
tttccttgttaa

DBGET integrated database retrieval system