KEGG   Candidatus Midichloria mitochondrii: midi_01006Help
Entry
midi_01006        CDS       T01561                                 

Gene name
dnaQ
Definition
DNA polymerase III subunit epsilon (EC:2.7.7.7)
Orthology
K02342  
DNA polymerase III subunit epsilon [EC:2.7.7.7]
Organism
mmn  Candidatus Midichloria mitochondrii
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:mmn00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    midi_01006 (dnaQ)
   00240 Pyrimidine metabolism
    midi_01006 (dnaQ)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    midi_01006 (dnaQ)
   03430 Mismatch repair
    midi_01006 (dnaQ)
   03440 Homologous recombination
    midi_01006 (dnaQ)
Enzymes [BR:mmn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     midi_01006 (dnaQ)
DNA replication proteins [BR:mmn03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     midi_01006 (dnaQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
945811..946488
Genome map
AA seq 225 aa AA seqDB search
MADLREIVLDTETTGLRVKHGHRIIEIGCVELVNKVRTGKTFHTYLNPQRKIDPTAYEVH
GISDELVADKPTFSKVAEQFMEFIGNSNLIIHNAVFDMQFINQELTLSGRYTLPMHRAID
TLLMARKKFPGSQASLDALCRRFNISLHAREKHGALVDAELLALVYIEMSSGSQGQIRLD
ASINRAINLRNYPYRIFEASADELRRHAYIMKLIKEPIWMKSDSA
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggcagatttgagagaaatagttttagatactgaaacaacagggctcagagtaaagcac
ggacaccgaataattgaaataggatgtgtagaattagttaacaaagttagaactggtaaa
acttttcatacctacttgaatccgcaaagaaaaatagaccctacagcatatgaagtgcat
ggcatttcagatgaacttgtagctgacaagcccacattctcaaaggttgcagagcaattt
atggaatttattggcaatagcaatttgattatccataatgctgtatttgatatgcaattt
attaatcaagagttaactttatcaggtcgctataccttacctatgcatagggctatagat
acacttttaatggcgagaaaaaagttccccggttctcaagcaagccttgatgccttatgt
agacgttttaatattagcctccatgccagagaaaaacacggagctcttgtcgatgctgaa
ttattggcattagtttatatagagatgagcagtggaagccaaggccaaattaggctagat
gcgagcattaatagagcgataaatcttagaaattatccttatcggatttttgaagcatca
gctgacgaacttagaaggcatgcatatattatgaagttaattaaagagccgatttggatg
aaaagtgattcagcctag

DBGET integrated database retrieval system