KEGG   Mycoplasma mobile: MMOB1170Help
Entry
MMOB1170          CDS       T00176                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mmo  Mycoplasma mobile
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mmo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MMOB1170 (galU)
   00052 Galactose metabolism
    MMOB1170 (galU)
   00500 Starch and sucrose metabolism
    MMOB1170 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    MMOB1170 (galU)
Enzymes [BR:mmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MMOB1170 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
174637..175515
Genome map
AA seq 292 aa AA seqDB search
MNKKVRKAIIPAAGWGTRFLPITKVIHKELLPILKKPAIEILIEEAFEAGIEEIILVISS
RKQELKRYFEVNHDLELELFKNKKWDLLKSLKTTNINAKIRIVYQEKQLGLGHAIAVGAQ
WIDDEPFAVILGDDLIKSKEPAIKQLIREFDDKQASILGVQAVEERDLNKYGVVVPFKGY
DPKDKSFKIIGAVEKPKIENAPSNKAILGRYIFTPRIIDILTNLKPSKTSNEIDVIDAFS
KLLKEEDIYAYQFSGTRYDIGNIEGFVKATIDYALDDDKLREVVLEHIKEKV
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaaagtaagaaaagcaattatcccagcagcaggatgaggtacaagattttta
ccaataacaaaagtaatccacaaagaactactaccaattttaaaaaaaccagcaattgaa
attttaattgaggaagcatttgaagcaggaattgaagagattattttggttatttctagt
agaaagcaagaactaaaaagatattttgaagtcaatcacgatttagagttagaattattt
aaaaacaaaaaatgagaccttcttaaatcattaaaaacaactaatattaatgcaaaaatt
agaattgtttaccaagaaaaacaacttggtttaggacatgcaatagcagtgggagcacaa
tggattgatgatgaaccattcgcagtaattttaggggatgatctaattaaatcaaaagaa
ccagcaataaaacaacttattagagaatttgatgataagcaagcttcgattttaggtgta
caagcagttgaagaaagggatttaaataaatatggtgttgttgttccttttaaaggatac
gatcctaaagataaaagctttaaaattataggagcagttgaaaaaccgaaaattgaaaat
gctccttccaataaagcgattcttggaagatatatttttactccaagaataattgatatt
ttgacaaatctaaaaccttcaaaaacaagtaatgaaatagatgttatagatgccttttca
aaattattaaaagaagaagatatttatgcttaccaattctcagggacaagatacgatata
ggtaatattgaaggatttgtaaaagctacaattgattatgctttagatgatgataaacta
agagaagtggttttagaacacattaaagagaaagtttaa

DBGET integrated database retrieval system