KEGG   Mycoplasma mobile: MMOB2030Help
Entry
MMOB2030          CDS       T00176                                 

Gene name
glcK
Definition
(GenBank) putative sugar binding signalling protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
mmo  Mycoplasma mobile
Pathway
mmo00010  Glycolysis / Gluconeogenesis
mmo00052  Galactose metabolism
mmo00500  Starch and sucrose metabolism
mmo00520  Amino sugar and nucleotide sugar metabolism
mmo01100  Metabolic pathways
mmo01110  Biosynthesis of secondary metabolites
mmo01120  Microbial metabolism in diverse environments
mmo01130  Biosynthesis of antibiotics
mmo01200  Carbon metabolism
Module
mmo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mmo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MMOB2030 (glcK)
   00052 Galactose metabolism
    MMOB2030 (glcK)
   00500 Starch and sucrose metabolism
    MMOB2030 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    MMOB2030 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MMOB2030 (glcK)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    MMOB2030 (glcK)
Enzymes [BR:mmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     MMOB2030 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase Hydant_A_N
Motif
Other DBs
NCBI-ProteinID: AAT27689
UniProt: Q6KI87
Position
272191..273078
Genome map
AA seq 295 aa AA seqDB search
MKIGSIDIGGTNARIAIFENDVIIRKFKFPTDINSPEISLKPIIEKINEENLEYIALCVP
GPTDYKNGIVLYPPTMPGWWNFKLKEYLNKNTRIKDSIFENDANAMAMAVHREFNQTFND
VTQFFTISTGLGAGLVIKDEVFIGVNHAAQEINSLPASFIKESGGNNSMGGVELFSSGSG
LENRAKRRNYNWKAKEMFELYDKNVLAKRLIDEGIETLANLIAISLAMLNPSQIVFGGTV
ALKNKWYVEAAIKQAKSRSLAIQYDNVKFRFTSYEDDTALYGLYHIVKNKFTIKN
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataggatcaattgatattggtggaacaaatgcaagaattgcaatttttgaaaat
gatgttattataaggaaatttaaatttcctacagatattaatagcccagaaatttcttta
aaaccaattattgaaaaaataaatgaagaaaatttagaatatattgccctttgtgttcct
gggcctacagattataaaaatggaatagttttataccctccaacaatgccaggatgatga
aactttaaactaaaagaatatttaaataaaaatactagaattaaagattctatttttgaa
aatgatgcaaatgctatggccatggcagttcatcgtgaatttaatcaaacatttaatgat
gttacacaattttttacaataagcacaggacttggagcagggctcgttattaaagatgaa
gtttttattggtgtaaatcatgctgctcaagaaatcaattctttaccagcatcttttatt
aaagaatcaggcggaaataactcaatgggtggtgttgaattattctcatcaggatcaggt
ttagaaaaccgtgctaaaagaagaaattacaattgaaaagcaaaagaaatgtttgaactt
tatgataaaaatgttttagcaaaaagattaatcgatgaaggaattgaaactcttgctaat
ttaattgctatttctttggcgatgttaaatccgagtcaaattgtttttggaggaactgtt
gcattaaaaaataaatgatatgttgaagctgctataaaacaagcaaaaagtagaagttta
gcaattcagtatgataatgtaaaatttagatttacttcttatgaagatgatactgcttta
tatggtttatatcacattgtaaaaaacaaatttactattaaaaattag

DBGET integrated database retrieval system