KEGG   Mycoplasma mobile: MMOB2030Help
Entry
MMOB2030          CDS       T00176                                 

Gene name
glcK
Definition
putative sugar binding signalling protein (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
mmo  Mycoplasma mobile
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mmo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MMOB2030 (glcK)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MMOB2030 (glcK)
   00052 Galactose metabolism
    MMOB2030 (glcK)
   00500 Starch and sucrose metabolism
    MMOB2030 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    MMOB2030 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MMOB2030 (glcK)
   00524 Butirosin and neomycin biosynthesis
    MMOB2030 (glcK)
Enzymes [BR:mmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     MMOB2030 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
272191..273078
Genome map
AA seq 295 aa AA seqDB search
MKIGSIDIGGTNARIAIFENDVIIRKFKFPTDINSPEISLKPIIEKINEENLEYIALCVP
GPTDYKNGIVLYPPTMPGWWNFKLKEYLNKNTRIKDSIFENDANAMAMAVHREFNQTFND
VTQFFTISTGLGAGLVIKDEVFIGVNHAAQEINSLPASFIKESGGNNSMGGVELFSSGSG
LENRAKRRNYNWKAKEMFELYDKNVLAKRLIDEGIETLANLIAISLAMLNPSQIVFGGTV
ALKNKWYVEAAIKQAKSRSLAIQYDNVKFRFTSYEDDTALYGLYHIVKNKFTIKN
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataggatcaattgatattggtggaacaaatgcaagaattgcaatttttgaaaat
gatgttattataaggaaatttaaatttcctacagatattaatagcccagaaatttcttta
aaaccaattattgaaaaaataaatgaagaaaatttagaatatattgccctttgtgttcct
gggcctacagattataaaaatggaatagttttataccctccaacaatgccaggatgatga
aactttaaactaaaagaatatttaaataaaaatactagaattaaagattctatttttgaa
aatgatgcaaatgctatggccatggcagttcatcgtgaatttaatcaaacatttaatgat
gttacacaattttttacaataagcacaggacttggagcagggctcgttattaaagatgaa
gtttttattggtgtaaatcatgctgctcaagaaatcaattctttaccagcatcttttatt
aaagaatcaggcggaaataactcaatgggtggtgttgaattattctcatcaggatcaggt
ttagaaaaccgtgctaaaagaagaaattacaattgaaaagcaaaagaaatgtttgaactt
tatgataaaaatgttttagcaaaaagattaatcgatgaaggaattgaaactcttgctaat
ttaattgctatttctttggcgatgttaaatccgagtcaaattgtttttggaggaactgtt
gcattaaaaaataaatgatatgttgaagctgctataaaacaagcaaaaagtagaagttta
gcaattcagtatgataatgtaaaatttagatttacttcttatgaagatgatactgcttta
tatggtttatatcacattgtaaaaaacaaatttactattaaaaattag

DBGET integrated database retrieval system