KEGG   Mycoplasma mobile: MMOB2060Help
Entry
MMOB2060          CDS       T00176                                 

Gene name
gap1
Definition
(GenBank) amino acid permease
Organism
mmo  Mycoplasma mobile
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
275514..277109
Genome map
AA seq 531 aa AA seqDB search
MNQSSFKKTSKIKDNKFTNKQYFFYAINHIIGFGFIATISGVLNLGSFGILVFAIAAFIS
FVVALVFSRAAQAFPDTVGGSYAYAKKAFGRKMAFLNGWNQYMQGPLLSASAPLFLANIL
ISFDPDNVIIYSSVSILIFVLLNIIATLGINFSKKFLFSFASIKWAIIAIAFFIVIVIAF
INRSFAENIQTTRAVGAAVIFGSVVSFLFAFGGFGAITAISKDTKTQNFRKLLMFVFYIV
LIFYFLFYIFFLGINTSPLINSDPFARIYIIAFGTTGLVLFTIGLFFNQSSARISATIAI
GRGLSPLAADGFFPHYLSKKNSKNEYKNAIYFSATLSIISMIFLNIIPRVLNLQDSFNNI
LQIGTLGFLLQYILTTWTVLVLKYKKLINKIPLWELLVYYLGLIIMITVFVVVLIPPTVG
APWTLAETIKTPTFIFALSLGFVVWYFTSLDKKRAKKYHLKGFNSALNYNFQIPKYNTFK
IWNLFLVILMNLLLPVLGTIIYLFIVYDKKRMHNFYLQGIENKSLDFYSES
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaatctagttttaaaaaaacatctaaaataaaagacaataaatttacaaataaa
caatattttttctatgcaataaatcatattattggttttggttttatagcaacaatttca
ggggtgttaaatcttggaagttttggtattttggtttttgcaatagcagcctttatttcg
tttgttgtagctttagtattttcaagagcagctcaagctttcccagatactgtaggcgga
tcttatgcttatgcaaaaaaagcatttggaagaaaaatggcttttttaaatggttgaaat
caatatatgcaaggtcctttactttctgcttcagcgccattatttttagcaaatatttta
atttcttttgatccagataatgtaataatttattcttctgtttctattttaatttttgtt
ttgctaaatattattgcaacattaggtattaatttttcgaaaaaatttcttttttctttt
gcttcaattaaatgagcaattattgcaatagctttttttatagtcattgtgattgcattt
ataaatagaagttttgcagaaaatatccaaacaactagagcagtgggtgctgcagtaatt
tttggaagtgtagtttcatttttatttgcttttggtggttttggagcaattacagcaatt
tctaaagatactaaaactcaaaattttagaaaattattaatgtttgttttttatattgtt
ttgattttttactttcttttttatattttctttttaggaataaatacaagccctttaatc
aactcagatccttttgcaagaatttatatcattgcttttggaacaacaggattagtttta
tttacaataggtttattttttaatcaatcttctgcaagaattagtgcaactatagcaata
ggtagaggtttatcacctttagcagctgatggcttttttcctcattatttaagtaaaaaa
aattctaaaaatgaatataaaaatgcgatttatttttcagcaacactatcaattatttca
atgatttttttaaatattattccaagggttcttaatttacaagattcttttaataatatt
cttcaaattggaacactaggttttttacttcaatatattcttacaacttgaacagtttta
gttttaaaatataaaaaacttattaataaaatccctttatgagagttattggtctattat
ttaggtttaataataatgattactgttttcgttgttgtgttaattccgccaacagttgga
gctccttgaactttagcagaaacaataaaaactccaacttttatttttgctttatcttta
ggttttgttgtttgatattttacaagtcttgataaaaaaagagcaaaaaaatatcactta
aaaggatttaattctgctttaaattataatttccagattcctaaatacaacacttttaaa
atttgaaatttatttctagttattttaatgaatcttttactaccagttttaggaacaata
atctatttatttatagtttatgacaaaaaaagaatgcataatttttatttacaaggaatt
gaaaataaatctctagatttttattcagaatcataa

DBGET integrated database retrieval system