KEGG   Mycoplasma mobile: MMOB2070Help
Entry
MMOB2070          CDS       T00176                                 

Gene name
atpC
Definition
(GenBank) ATP synthase epsilon chain
  KO
K02114  F-type H+-transporting ATPase subunit epsilon
Organism
mmo  Mycoplasma mobile
Pathway
mmo00190  Oxidative phosphorylation
mmo01100  Metabolic pathways
Module
mmo_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:mmo00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    MMOB2070 (atpC)
Photosynthesis proteins [BR:mmo00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   MMOB2070 (atpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-synt_DE_N ATP-synt_DE
Motif
Other DBs
NCBI-ProteinID: AAT27693
UniProt: Q6KI83
Position
complement(277370..277795)
Genome map
AA seq 141 aa AA seqDB search
MSKNKTKLIITTPQGYFFNDDVEIVTLKTTEGYIGIQKDSQSLIASIKPSKLFINQINSK
DLKICAISGGIAFIDKNEIKIITDAIEFKEDIDLERAKKGKEIIEQKLKKPNLSKSKIEE
YNLKIEKANNRINVKNNSDTF
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaaaataagacaaaattaattatcacaacacctcaaggatattttttcaatgat
gatgttgaaattgttactctcaaaacaactgaaggctatataggaattcaaaaagattct
caatcattaattgcatcaattaaaccttctaaattatttattaatcaaattaatagcaaa
gatttaaaaatatgtgcaatttctggtgggattgcttttattgataaaaatgaaattaaa
attattactgatgctatcgaatttaaagaagacattgatttagaaagagctaaaaaagga
aaagaaattatagagcaaaaactaaaaaaacccaatttaagtaaaagtaaaattgaagaa
tataatctaaaaatagaaaaagctaataatagaataaatgttaaaaataattcagatacc
ttctaa

DBGET integrated database retrieval system