KEGG   Mycoplasma mobile: MMOB2100Help
Entry
MMOB2100          CDS       T00176                                 

Definition
(GenBank) ATP synthase operon intergenic protein
Organism
mmo  Mycoplasma mobile
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LapA_dom
Motif
Other DBs
NCBI-ProteinID: AAT27696
UniProt: Q6KI80
Position
complement(280073..280195)
Genome map
AA seq 40 aa AA seqDB search
MSFFEEIKMKMQIRKEKKKIEKMQKTLELLEKDSKVKSDK
NT seq 123 nt NT seq  +upstreamnt  +downstreamnt
atgagtttttttgaagaaataaaaatgaaaatgcaaataagaaaagaaaagaaaaaaata
gaaaaaatgcaaaaaaccttagaacttttagaaaaagatagcaaagtgaaaagcgataaa
taa

DBGET integrated database retrieval system