KEGG   Mycoplasma mobile: MMOB2110Help
Entry
MMOB2110          CDS       T00176                                 

Gene name
atpA
Definition
(GenBank) ATP synthase alpha chain
  KO
K02111  
F-type H+-transporting ATPase subunit alpha [EC:3.6.3.14]
Organism
mmo  Mycoplasma mobile
Pathway
Oxidative phosphorylation
Metabolic pathways
Module
F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:mmo00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    MMOB2110 (atpA)
Enzymes [BR:mmo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.14  H+-transporting two-sector ATPase
     MMOB2110 (atpA)
Photosynthesis proteins [BR:mmo00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   MMOB2110 (atpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(280237..281808)
Genome map
AA seq 523 aa AA seqDB search
MSIKASDISSIIKQQIKDFNVTSDKKEIGEILTVGDGIAYVSGLENARLGELVVFENENY
GLVLNLEEYAVGVAIMDGSNDLIEGQKVRRTGKVISVKVGDQLIGRVLNGLGEPIDGLGQ
ITSTKTRKIFQIAPGVMTRKEVNVPLDTGIITIDSMIPIGRGQRELIIGDRQTGKTAIAM
DTIINQKDKDVLCIYVAIGQKNSSIAQIVQKLKDHDAMKYTTVINSSASELAPLQYIAPY
TGVTIAEEWMANGKDVLIVYDDLSKHAIAYRTLSLLLRRPPGREAFPGDVFYLHSQLLER
AARVTKEFGGGSITALPIVETQSGDISAYIPTNIISITDGQIFTIESLFKSGQRPAIDIG
FSVSRVGSAAQIPAIKSFASSLKLELAQYNEVKAFAQFGSDLDETTTNILKHGQKIYEIL
KQSQYSPISQFYQAIILLAIKEKLISQIPVEKIRKYRSELIKFIKNNSEIIALRPIIEKE
KINNDIKEKLIYSIKSFVKKFILENDIIIDNGQNNDVQFINKK
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgtctataaaagcaagtgatatttcttcaataattaaacaacaaattaaagattttaat
gtcacatcagataaaaaagaaattggtgaaattcttactgttggagatggaattgcttat
gttagtggtttagaaaatgcccgtctaggagagttggtagtttttgaaaatgaaaattat
ggacttgttttaaatctagaagaatatgcggttggtgttgcgattatggatggttcaaat
gatttaattgaaggccaaaaagtaaggagaacaggtaaagttatttcggtaaaagtggga
gatcaactaattggaagagtattaaatggacttggagaaccaattgatggtttagggcaa
attacttcaacaaaaactagaaaaattttccaaatagctcctggggttatgacaagaaaa
gaagtaaatgttcctttagatactggtattattacaattgatagtatgatcccgatcggt
agaggtcaaagagaattaattataggtgatcgacaaacaggtaaaactgcaattgctatg
gatacaattattaatcaaaaagataaagatgttttatgtatttatgtagcaataggacaa
aaaaattcttcgattgcacaaatagttcaaaaattaaaagatcatgatgcaatgaaatac
actacagttatcaattctagcgctagcgaattggctccactacaatatattgctccttat
acaggagttacaattgctgaggaatgaatggcaaacggaaaagatgttttaatagtttat
gatgatttatcaaaacatgctattgcttatcgtaccttatcattactgttaagaagacct
cctggtcgagaagcatttccaggagatgtattttatttacactcacagcttttagaaaga
gctgcaagagtaacaaaagaatttggaggtggatcaattacagccttaccaattgtcgaa
acacaaagtggagatatttcagcatatatcccaacaaatattatctcaatcactgatggt
caaattttcacaattgagtctctttttaaaagtggccaaagacctgcaattgatattggt
tttagtgttagtcgtgttggtagtgctgcacaaattcctgctattaagagttttgcttct
tcattaaaattagaattagctcaatataatgaagtgaaagcatttgcacaatttggaagt
gatttagatgaaactacaacaaatattttgaaacatggtcaaaaaatatatgaaatttta
aaacaatctcagtattcaccaatttctcaattttaccaagcaattattttacttgctatt
aaggaaaaattaatatctcaaattccagttgaaaaaattagaaaatatcgttcagaattg
attaaatttattaaaaataattctgaaataatagcattaaggccaataattgaaaaagaa
aaaataaataatgatatcaaagaaaaattaatttattcaataaaatcttttgttaaaaaa
tttattttagaaaatgacataattatagataatggacagaataatgatgttcagtttatt
aataaaaaatag

DBGET integrated database retrieval system