KEGG   Mycoplasma mobile: MMOB2150Help
Entry
MMOB2150          CDS       T00176                                 

Gene name
atpB
Definition
(GenBank) ATP synthase a chain
  KO
K02108  F-type H+-transporting ATPase subunit a
Organism
mmo  Mycoplasma mobile
Pathway
mmo00190  Oxidative phosphorylation
mmo01100  Metabolic pathways
Module
mmo_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:mmo00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    MMOB2150 (atpB)
Photosynthesis proteins [BR:mmo00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   MMOB2150 (atpB)
Chaperones and folding catalysts [BR:mmo03110]
 Other chaperones and cochaperones
  PapD
   MMOB2150 (atpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-synt_A ECSCR
Motif
Other DBs
NCBI-ProteinID: AAT27701
UniProt: Q6KI75
Position
complement(283225..284031)
Genome map
AA seq 268 aa AA seqDB search
MEGIKMANNTEENILLSQINNWIQPQLISLIFVTLVLILISVVVYFKVKKVKPNESPYGV
ALLSEQYVTFVDDNFQAITGGKIDKVGPYIFTLITFLVVGNILGIFGLEPITTSYSVPLT
LALITWLGTYVIAIIFQKWRKLRKYLKVTLPFILIGEFSPIISLSFRIFGNIIGGSTILF
LIYFVTGYIWGFIPIIGQVNLLGAVLAPALNLYFDLFGGLIQAYLFTILTMVFWTLETDI
PEKKKKKILRKDIASKTTLENEKKLQLV
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggaaggaataaaaatggcaaataatacagaagaaaacatattgcttagtcaaataaat
aattgaattcaacctcaattgataagtttgatttttgtaacacttgtcttaattcttatt
agtgttgttgtttattttaaagttaaaaaggtaaaacctaatgagtctccttatggagtt
gctttattatcagaacaatatgtgacttttgttgatgataattttcaagcaattacaggt
ggtaaaattgacaaagttggtccatatatttttactttaattacttttttagttgttgga
aatattttaggaatttttggtttagaaccaattactacttcttattcagttccattaact
ttagcattaatcacttgattaggcacatatgtgattgcaattatttttcaaaaatgaaga
aaattaagaaaatatttaaaagttactcttccatttattttaataggagaattttcacca
ataatttctttgtcgtttaggatttttgggaatattattggcggatcgacaattttgttt
cttatttattttgtaacaggatatatttgaggttttattccaataataggtcaagtaaat
ttacttggagctgtgcttgcgccagcattaaatctttactttgatttatttggtggtcta
attcaagcatatttatttacaatactcacaatggtattttgaactttagaaacagatatt
ccggaaaaaaagaagaagaaaattttaagaaaagatatagcaagtaaaacaacattagaa
aatgaaaaaaaactacaattagtttaa

DBGET integrated database retrieval system