KEGG   Mycoplasma mobile: MMOB2190Help
Entry
MMOB2190          CDS       T00176                                 

Definition
(GenBank) hypothetical protein
Organism
mmo  Mycoplasma mobile
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VMA21
Motif
Other DBs
NCBI-ProteinID: AAT27705
UniProt: Q6KI71
Position
286034..286453
Genome map
AA seq 139 aa AA seqDB search
MRKKNMKIKKIWTKIKINWKNYLIFFSPFLITIPVISYFVITSNKNENIKIINFKNPLSF
PEIKIEKYNKFLKKNLNGELKIDDSFLVHIIKDILVKFSEHNLDLTYATKIESEKLAFIF
FKWDYKNQINTKNFKIELQ
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
ttgagaaaaaagaatatgaaaattaaaaaaatatgaactaaaattaagattaattgaaag
aattatttaattttcttttccccatttttaattactattccagttatttcttattttgta
attacaagtaataaaaatgaaaatatcaagataattaattttaaaaatcctctctctttt
cctgagataaaaatagaaaaatataacaaatttttgaagaaaaacttaaatggagaatta
aaaattgatgatagttttttggttcatattattaaagatattttagtaaaattttcagaa
cataatctagatttaacatatgctacaaaaatcgaatctgaaaaacttgcatttattttt
tttaaatgagattataaaaaccaaattaatacaaaaaatttcaaaatagaacttcaataa

DBGET integrated database retrieval system