KEGG   Mycoplasma mobile: MMOB2210Help
Entry
MMOB2210          CDS       T00176                                 

Gene name
focA
Definition
(GenBank) formate/nitrite family of transporters
  KO
K21993  
formate transporter
Organism
mmo  Mycoplasma mobile
Brite
Transporters [BR:mmo02000]
 Other Transporters
  Pores ion channels [TC:1]
   MMOB2210 (focA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(286868..287803)
Genome map
AA seq 311 aa AA seqDB search
MLDYKSNFDNAMDFALKKASADWWKIIVLGILASIYVGIGYIAYIYVAAAFQGNLIGIDS
VHFDGSVVVAASATFPVGLMLIVFLGGSLFTSDNLSMLAYITKKTKFSPLLRKWGYVLLG
NTIGGFLIAILIRAGSIFNDNQLIVLKYIIDKKIDFQWWTIIFSAILCNIIVAGTVWASL
ATTQSIGKIFIIFFPIWIFAIIGFQHVVANAILFAMGWLHGDNPIIAGGIVTIGNNSVNY
GKKLIDWTSIALHSNLIPALIGNWFAGSILLPYAYLSVVKIRSKSEKQRMKDNAGNLTDS
EDPDKKDENKK
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgcttgattacaaatcaaattttgataatgcaatggattttgcattgaaaaaagcaagt
gcggattgatgaaaaattattgttctgggaattttagcatcaatttatgttggaatcgga
tacatcgcttacatatatgttgctgcagcatttcaagggaatttgataggaattgattca
gtacattttgatggatcagttgtggttgcggcaagcgcaacctttcctgtaggattaatg
ttaattgtttttttaggtggaagtctctttacaagcgataatttatcaatgcttgcttac
atcacaaagaaaacaaaattttctccattgcttagaaaatgaggatatgttttacttggt
aacactattggtggatttttaattgctattttaattagagcaggaagtatttttaatgac
aatcaattgattgttctaaaatatattattgataaaaaaatagattttcaatgatgaact
attatattttccgctattttatgcaatataattgtcgcaggaacagtttgagcttctcta
gcaacaacacagtcaattggaaaaatctttatcattttctttccaatatgaatttttgca
attatagggtttcaacacgtagtagctaatgcgatactatttgctatggggtgattgcat
ggtgataatccgattattgctggagggattgtaacaattggaaataacagcgtaaattat
ggtaaaaaacttattgattgaacttctatagcattgcattctaatttaattccagcttta
ataggtaattgattcgcaggttctatcttattaccgtatgcatatttatcggttgtgaaa
attagatcaaaaagcgaaaaacaaagaatgaaagataatgcaggaaatttaacagattct
gaagatccagataaaaaagatgaaaataaaaaataa

DBGET integrated database retrieval system