KEGG   Mycoplasma mobile: MMOB2350Help
Entry
MMOB2350          CDS       T00176                                 

Gene name
rplC
Definition
(GenBank) 50S ribosomal protein l3
  KO
K02906  
large subunit ribosomal protein L3
Organism
mmo  Mycoplasma mobile
Pathway
Ribosome
Module
Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:mmo00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    MMOB2350 (rplC)
Ribosome [BR:mmo03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    MMOB2350 (rplC)
  Bacteria
    MMOB2350 (rplC)
  Archaea
    MMOB2350 (rplC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
298371..299264
Genome map
AA seq 297 aa AA seqDB search
MKGILGQKIGMTQIYTAQGNKVPVTVIEVKPNVVTHKFENTKDGYVALQLGAFDQKERKF
KKPEIGHFKKSNTTPKRFVKEIRNMDGYNLGDLVKADIFKSGELVDVTGISKGKGFAGTI
KRHNQKIGPKSHGGGGGSKPVRQTGSIGDIAGNKVLKGMTMPGHLGNVQRTIQNLEVVKV
DIKNNILLVKGSVPGPKNCFLIIKSAIKNLPSREAIELVNIKEAILKNQLLESAKKYGAE
VSVDMKIHEMEEIIHAAMKEKEKLEQEAKQNAEKSNSDDDVRKEAEKLNKNKEDKGE
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggaatcttaggacaaaaaattgggatgactcaaatttatacagcacaaggaaac
aaagttcctgtaactgtaattgaagttaaaccaaatgttgttacacataaattcgaaaac
actaaagatggctatgttgcattgcaacttggtgcttttgatcaaaaagaaagaaaattt
aaaaaaccagaaattggtcattttaaaaaatcaaacacaacgcctaagcgcttcgttaaa
gaaatccgtaatatggatggatataatcttggcgatttagtaaaagcagacatttttaaa
agtggagagctagttgatgttacaggaatttcaaaaggaaaaggatttgctggaacaatc
aaaagacacaatcaaaaaatcggtccaaaatcgcatggtggtggtggtggatcaaaacca
gttagacaaacaggatcaattggagatattgctggaaacaaagttcttaaaggtatgaca
atgcctggtcatttaggaaatgtacaaagaacaattcaaaatttagaagttgtaaaagta
gatatcaagaacaatattttgttagtaaaaggatctgtcccagggccaaaaaattgtttt
ttaattattaaaagcgctattaaaaatcttccttcaagagaagcaattgaattagttaat
attaaagaagcaattctaaaaaaccaattacttgaatcagctaaaaaatatggtgctgaa
gtaagtgttgatatgaaaattcatgagatggaagaaataattcatgcagcaatgaaagaa
aaagaaaaattagaacaagaagctaaacaaaatgctgaaaaatctaattcagatgatgat
gttagaaaagaagcagaaaaattaaacaaaaataaagaagataaaggagaatag

DBGET integrated database retrieval system