KEGG   Mycoplasma mobile: MMOB2350Help
Entry
MMOB2350          CDS       T00176                                 

Gene name
rplC
Definition
(GenBank) 50S ribosomal protein l3
  KO
K02906  large subunit ribosomal protein L3
Organism
mmo  Mycoplasma mobile
Pathway
mmo03010  Ribosome
Module
mmo_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:mmo00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    MMOB2350 (rplC)
Ribosome [BR:mmo03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    MMOB2350 (rplC)
  Bacteria
    MMOB2350 (rplC)
  Archaea
    MMOB2350 (rplC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L3
Motif
Other DBs
NCBI-ProteinID: AAT27721
UniProt: Q6KI55
Position
298371..299264
Genome map
AA seq 297 aa AA seqDB search
MKGILGQKIGMTQIYTAQGNKVPVTVIEVKPNVVTHKFENTKDGYVALQLGAFDQKERKF
KKPEIGHFKKSNTTPKRFVKEIRNMDGYNLGDLVKADIFKSGELVDVTGISKGKGFAGTI
KRHNQKIGPKSHGGGGGSKPVRQTGSIGDIAGNKVLKGMTMPGHLGNVQRTIQNLEVVKV
DIKNNILLVKGSVPGPKNCFLIIKSAIKNLPSREAIELVNIKEAILKNQLLESAKKYGAE
VSVDMKIHEMEEIIHAAMKEKEKLEQEAKQNAEKSNSDDDVRKEAEKLNKNKEDKGE
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggaatcttaggacaaaaaattgggatgactcaaatttatacagcacaaggaaac
aaagttcctgtaactgtaattgaagttaaaccaaatgttgttacacataaattcgaaaac
actaaagatggctatgttgcattgcaacttggtgcttttgatcaaaaagaaagaaaattt
aaaaaaccagaaattggtcattttaaaaaatcaaacacaacgcctaagcgcttcgttaaa
gaaatccgtaatatggatggatataatcttggcgatttagtaaaagcagacatttttaaa
agtggagagctagttgatgttacaggaatttcaaaaggaaaaggatttgctggaacaatc
aaaagacacaatcaaaaaatcggtccaaaatcgcatggtggtggtggtggatcaaaacca
gttagacaaacaggatcaattggagatattgctggaaacaaagttcttaaaggtatgaca
atgcctggtcatttaggaaatgtacaaagaacaattcaaaatttagaagttgtaaaagta
gatatcaagaacaatattttgttagtaaaaggatctgtcccagggccaaaaaattgtttt
ttaattattaaaagcgctattaaaaatcttccttcaagagaagcaattgaattagttaat
attaaagaagcaattctaaaaaaccaattacttgaatcagctaaaaaatatggtgctgaa
gtaagtgttgatatgaaaattcatgagatggaagaaataattcatgcagcaatgaaagaa
aaagaaaaattagaacaagaagctaaacaaaatgctgaaaaatctaattcagatgatgat
gttagaaaagaagcagaaaaattaaacaaaaataaagaagataaaggagaatag

DBGET integrated database retrieval system